KEGG   Terriglobus roseus: Terro_2237Help
Entry
Terro_2237        CDS       T02140                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
trs  Terriglobus roseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Terro_2237
Enzymes [BR:trs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Terro_2237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2661878..2663026)
Genome map
AA seq 382 aa AA seqDB search
MLRSIMLFCVLATPLTTLHAQTNDATVDMLKKLSDAPGPPGAEEPVRAIMYPVMKQNSSS
IKFDGLGSVIAQQGSAGPRIMVDAHMDELGGMVRRVTPNGFLTMQMLGGWLDQALVDQRW
IILGSKGPVHGVTGIRDIHVVPADERTRVYPRDSLMLDIGAKNAAEAAAMGIEPGDPVVP
DAPFMVLNGTDNYLGKAWDDRIGCAVLLAAMQRTKGTNVGNQIFYVATTQEEIGLRGART
AAQLVKPDIGIAIEGGIVGDTPGSRPEETQAKLGGGPGIFLYDSSALANRKLVAQVKKVA
AERKIPLQYDLVQGYGDDSAEMQVSNGGVPTINIVVPVRYTHAHNGIVNRKDFDQTVDFV
VALLQSLTQSTVNDLRDFTPSN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcttagatccatcatgctcttctgcgtgctcgccacccctttgactacacttcacgcg
cagacgaacgatgcgacggtcgacatgttgaagaagctctccgatgcgccgggacctcct
ggagcggaagagccagtgcgagccattatgtacccggtgatgaagcaaaactcatcctcc
atcaagttcgacggcctgggttctgtcatcgcgcagcagggaagtgcggggccgcggatc
atggtggacgcgcacatggatgagctcggaggtatggtccgtcgggtgacgccaaacggc
ttcctcacgatgcagatgctgggaggctggcttgaccaggcgttggtcgatcagcgttgg
atcattctcggcagcaagggacccgtccacggcgtcaccggcatccgtgacattcatgtg
gtcccggcggatgagcggaccagggtgtatccccgtgacagcctgatgctggacatcggc
gcgaagaacgctgcggaagctgctgcgatgggcatagagcccggcgatccagtcgtgccc
gatgcgcccttcatggtgctgaatggaacggataactatcttggcaaagcgtgggatgac
agaatcggatgtgccgtgttgctcgcagcgatgcaacgtacgaaaggcaccaacgtcgga
aatcagatcttctacgtggctacgacacaagaggagattggactgcgtggcgccagaaca
gccgcgcagttagtaaaaccagatatcggcatcgcgatcgagggcggcatcgttggagac
acgcccggaagccgaccggaggagacgcaggcgaagctcggcggtggccccggtatcttc
ctgtatgactcaagtgcactggcgaatcgcaagctcgtcgcgcaggttaagaaggtggcc
gcagagcgcaagattccgctgcaatacgatctggtgcagggctacggagatgattctgcc
gagatgcaggtcagcaacggcggcgtgccgacgatcaacatcgtcgtgcccgtgcggtac
acacacgctcacaatggcatcgtgaaccggaaggatttcgatcagacggtggactttgtc
gttgcactgcttcagagtcttacgcagagtaccgtgaatgacctgcgggacttcacgcca
tctaattga

DBGET integrated database retrieval system