KEGG   Terriglobus roseus: Terro_2288Help
Entry
Terro_2288        CDS       T02140                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
trs  Terriglobus roseus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:trs01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:trs01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2722782..2723771
Genome map
AA seq 329 aa AA seqDB search
MSPVVDQAAAEQTRSTPVATAPVRLVPAAVEAREKAKMDLRMGREHQHGQVNWITAIAFG
AFHVLAVVALFFWSWSYVACFAVMYFLAINVGIGMTYHRLLTHRGYRVPRWLEIFMTACG
TMALEGGPIFWVATHRVHHQHSDQEGDPHTPHDGTWWAHIGWIITGRAMHSETALLGRYA
PDLTRDPAQRWLSKYHWLPLTIAGFLQMGLGYYMGGVKMMFGMVLWGTFLRVVVGVNATW
FVNSASHMFGPRRFETKDDSRNNWWVAILTGGEGWHNNHHAHPVSARHGLVWYEFDINYY
GIWLLKKLGIAKKVQIAKWDPSNPKPAGA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctgttgttgatcaagccgctgcagaacagactcgcagcacccccgtcgcaacc
gcgcctgtgcgccttgttccggcagccgtagaagctcgcgagaaggccaagatggacctc
cgcatgggccgcgagcaccagcacggacaagtgaactggattaccgccattgccttcggc
gcgttccatgttctggctgtggtagccctcttcttctggtcctggtcgtatgttgcctgc
ttcgccgtgatgtacttcctggcgatcaatgtcggcatcggcatgacgtatcaccgcctg
ttgacgcaccgcggctatcgcgttccccgctggcttgagatcttcatgaccgcctgcggc
accatggcccttgagggcggaccgatcttctgggtggccacgcaccgcgttcaccatcag
cacagcgaccaggaaggcgatccgcacacgccgcacgatggtacctggtgggcgcacatc
ggctggatcatcaccggccgcgccatgcatagtgagactgccctgctgggccgttacgcc
cctgaccttacccgcgatcccgcacagcgctggctgagcaagtaccactggctgccgctg
accattgccggcttcctgcagatgggccttggctactacatgggcggcgtgaagatgatg
ttcggcatggttctgtggggcacgttcctccgcgtagttgtcggtgtgaacgcgacctgg
ttcgtgaactcggcctcgcacatgttcggaccgcgccgctttgagacgaaggacgactcg
cgcaacaactggtgggtcgcgatccttaccggtggcgaaggctggcacaacaaccaccac
gctcatcccgtcagcgcgcgtcatggcctggtctggtacgagttcgacatcaactactac
ggcatctggctgctgaagaagctgggcatcgcaaagaaggtccagattgccaagtgggat
ccttcgaacccgaagcctgccggcgcttag

DBGET integrated database retrieval system