KEGG   Terriglobus roseus: Terro_2405Help
Entry
Terro_2405        CDS       T02140                                 

Definition
L-glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
trs  Terriglobus roseus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:trs00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:trs00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:trs00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2876574..2877623
Genome map
AA seq 349 aa AA seqDB search
MRSTQKILRIVFSASFLLASFTFVSAQSNRSPVAPTPEQFQSTLGNAYEKFKGDTGGKNA
DYIPYLAHVDSKLFGIAVVTTDGKLYKVGDVEYAFSIQSISKVFTLALAMEELGPDEVLA
KIGGEPTGRPFNSIPAVVDMPSHAGNPYVNAGAIATTSLISGADPVAKWAKILAFYSEAS
GSKLSLIDEVYKSEAATNTGNKAISMLLAKYDRIYANPFESVDVYTKQCSVGVTADQLAV
MGATLANNGKNPMTGKQVVKQDNVPHILAEMMMAGLYDGSGQWAWTVGIPAKSGVGGSIL
AVVPGKGAIAVFAPPLDEAGNSVKAQKVIGYVADKLGINLFAASSVGLK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagatcaacgcagaagattctgagaatcgtgttcagcgcaagcttcctgctggcttcc
ttcacattcgtcagcgctcaaagcaatcgaagtccagtcgcgcccaccccagaacagttc
caatcaacgctgggcaacgcatacgagaagttcaagggcgacacgggaggaaagaatgcg
gactatatcccgtacctcgctcatgttgactcgaaactgttcggcatcgcggttgtgacg
acagatggaaagctatacaaggttggggacgttgagtatgccttctccatacaatcgatc
tccaaggtgtttacgctagcgctggccatggaagaactcggccccgacgaagtgctggca
aagattggcggggagcctacggggcgaccgtttaattcgattcctgccgtggtcgatatg
ccgagccatgcgggcaacccatatgtgaatgccggtgcaatcgccacgacgagtctgatt
tcaggcgccgatcccgttgcaaagtgggcaaagatccttgctttttacagcgaagcaagc
ggaagcaagctttccttgatagacgaagtatataaatccgaggccgccaccaacacaggg
aataaggccatctcgatgctgttggcgaaatacgatcgcatctacgcgaatccgtttgaa
tcggtcgatgtttataccaagcaatgctcagtaggtgtcacggcggatcagttggcggtg
atgggagcaacgcttgccaacaacggaaagaatcctatgaccggcaagcaggtggtcaaa
caagataatgtcccacacatccttgcagaaatgatgatggccgggctgtatgacggctcc
ggacagtgggcctggaccgttgggatccccgcaaagagcggtgtaggagggtccattctt
gcagtagtgcccggaaaaggagcgatagctgtcttcgcgccaccattggacgaggctgga
aatagcgttaaagctcaaaaggtcattggatatgtcgccgacaagcttggcatcaatctt
ttcgcggcgagttcggttggtttgaagtaa

DBGET integrated database retrieval system