KEGG   Terriglobus roseus: Terro_2485Help
Entry
Terro_2485        CDS       T02140                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
trs  Terriglobus roseus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:trs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2973091..2973696
Genome map
AA seq 201 aa AA seqDB search
MERFAQPMARLIEELRKLPGVGNKSAQRLAFHILRSPNADAELLANAIRELKAQLRLCSI
CNNVTDVDPCTYCSSPTRTHATVCVVEEPTSIASIEKTRGYNGIYHVLHGTLSPLNGVGP
EQLRTANLFSRLGEIDEIILALSPTVEGEATSHWLANQLHQASADHPLRITRIATGVPAG
SDIEYADEITMSRAMEGRREI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcttcgcacaaccgatggcccgcctgatcgaagagctgcgcaagctgcccggc
gtcggcaacaaatccgcacaacgtctggccttccacatcctgcgctcgcccaacgccgac
gcggaactgctcgccaacgccatccgcgaactcaaagcgcaactgcggctttgcagtatc
tgcaacaacgtcaccgacgtcgatccctgcacctactgctcctcccccacccgcacgcac
gctacggtctgcgtcgtcgaagagccaaccagcatcgcgtccatcgaaaagacccgcggc
tacaacggcatctatcacgtcctccacggcacgctctccccgctcaacggcgtcggcccg
gaacaactgcgcaccgccaacctcttcagccgcctcggcgagatcgacgaaatcatcctc
gccctttcgcccaccgtcgagggagaagcaacatcacactggctcgcaaaccaactccat
caggccagtgccgaccatccgctgcgcatcacgcgtattgccaccggagtccccgcaggc
agcgacatcgagtacgccgacgaaatcaccatgagccgggcaatggaaggccgtcgcgag
atatag

DBGET integrated database retrieval system