KEGG   Terriglobus roseus: Terro_2601Help
Entry
Terro_2601        CDS       T02140                                 

Definition
(GenBank) peptidase family protein
Organism
trs  Terriglobus roseus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3122397..3123545)
Genome map
AA seq 382 aa AA seqDB search
MLRSIMLFCVLATPLTTLHAQTNDATVDMLKKLSDAPGPPGAEEPVRAIMYPVMKQNSSS
IKFDGLGSVIAQQGSAGPRIMVDAHMDELGGMVRRVTPNGFLTMQMLGGWLDQALVDQRW
IILGSKGPVHGVTGIRDIHVVPADERTRVYPRDSLMLDIGAKNAAEAAAMGIEPGDPVVP
DAPFMVLNGTDNYLGKAWDDRIGCAVLLAAMQRTKGTNVGNQIFYVATTQEEIGLRGART
AAQLVKPDIGIAIEGGIVGDTPGSRPEETQAKLGGGPGIFLYDSSALANRKLVAQVKKVA
AERKIPLQYDLVQGYGDDSAEMQVSNGGVPTINIVVPVRYTHAHNGIVNRKDFDQTVDFV
VALLQSLTQSTVNDLRDFTPSN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcttagatccatcatgctcttctgcgtgctcgccacccctttgactacacttcacgcg
cagacgaacgatgcgacggtcgacatgttgaagaagctctccgatgcgccgggacctcct
ggagcggaagagccagtgcgagccattatgtacccggtgatgaagcaaaactcatcctcc
atcaagttcgacggcctgggttctgtcatcgcgcagcagggaagtgcggggccgcggatc
atggtggacgcgcacatggatgagctcggaggtatggtccgtcgggtgacgccaaacggc
ttcctcacgatgcagatgctgggaggctggcttgaccaggcgttggtcgatcagcgttgg
atcattctcggcagcaagggacccgtccacggcgtcaccggcatccgtgacattcatgtg
gtcccggcggatgagcggaccagggtgtatccccgtgacagcctgatgctggacatcggc
gcgaagaacgctgcggaagctgctgcgatgggcatagagcccggcgatccagtcgtgccc
gatgcgcccttcatggtgctgaatggaacggataactatcttggcaaagcgtgggatgac
agaatcggatgtgccgtgttgctcgcagcgatgcaacgtacgaaaggcaccaacgtcgga
aatcagatcttctacgtggctacgacacaagaggagattggactgcgtggcgccagaaca
gccgcgcagttagtaaaaccagatatcggcatcgcgatcgagggcggcatcgttggagac
acgcccggaagccgaccggaggagacgcaggcgaagctcggcggtggccccggtatcttc
ctgtatgactcaagtgcactggcgaatcgcaagctcgtcgcgcaggttaagaaggtggcc
gcagagcgcaagattccgctgcaatacgatctggtgcagggctacggagatgattctgcc
gagatgcaggtcagcaacggcggcgtgccgacgatcaacatcgtcgtgcccgtgcggtac
acacacgctcacaatggcatcgtgaaccggaaggatttcgatcagacggtggactttgtc
gttgcactgcttcagagtcttacgcagagtaccgtgaatgacctgcgggacttcacgcca
tctaattga

DBGET integrated database retrieval system