KEGG   Terriglobus roseus: Terro_2632Help
Entry
Terro_2632        CDS       T02140                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
trs  Terriglobus roseus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Terro_2632
Enzymes [BR:trs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Terro_2632
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Terro_2632
Lipid biosynthesis proteins [BR:trs01004]
 Fatty acid synthase
  Component type
   Terro_2632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3164030..3164734
Genome map
AA seq 234 aa AA seqDB search
MLTVCAVLAISGCEAERHERPTDSTDGGATPLGSMTSHTPTVTPNAPTATDSRPVIAAFG
DSLTAGYGVDMESSYPADLQRDLDKAGYRYRVVNMGISGDTTKDGLARVERVLALKPAIV
VVEFGGNDGLRGVPVASSRTNLDSIVNKLQSSGTQVAMAGITLPPQYSQPYIKSFNETYT
LLAKKYHVPLLPFVLQDVYGVPGSIQQDGIHPTAQGCKQVSKNIFGLIKPLLKK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgacggtatgcgctgtgctggcgatctcaggttgcgaagccgaacgtcacgaacgc
cccaccgacagcaccgacggaggcgccacccccttgggatccatgacctcacacacacca
accgtcacaccgaatgctccgacggcgacagacagccgccccgtcattgccgcctttggc
gatagtctgacggctggctacggcgtggatatggaaagcagctaccccgctgacctgcaa
cgcgacctggacaaagccggttaccgctaccgcgtcgtgaacatgggtatcagcggcgac
accacgaaggatggcctcgcgcgcgtggagcgggtgctggcactgaaacctgctatcgtc
gtcgtcgaattcggcggaaacgacgggctgcgtggcgtaccggtggcgagttcgcgtacc
aacctggacagcatcgtcaataagctacagagcagcggcacgcaggtagccatggccggt
atcacgctgccgccgcagtacagtcagccctacatcaagtccttcaacgagacctatacg
ctgctcgcaaagaagtaccatgtgccactgctgccctttgtcctgcaggacgtctatggt
gtcccagggagtatccagcaagacggcatccaccccacagcgcagggctgcaagcaggta
tcgaagaacatctttggactgatcaaaccgctgttgaagaagtga

DBGET integrated database retrieval system