KEGG   Terriglobus roseus: Terro_2697Help
Entry
Terro_2697        CDS       T02140                                 

Definition
(GenBank) Mg-chelatase subunit ChlI
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
trs  Terriglobus roseus
Pathway
trs00860  Porphyrin and chlorophyll metabolism
trs01100  Metabolic pathways
trs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Terro_2697
Enzymes [BR:trs01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Terro_2697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat MCM ING AAA_3
Motif
Other DBs
NCBI-ProteinID: AFL88934
UniProt: I3ZI66
Position
3235064..3236590
Genome map
AA seq 508 aa AA seqDB search
MANKHSLPSDLPQTLGELRTSEWTFERVTRSVKDELRENLIAKLRAKETIFPGVVGYEDT
VIPQIVNAVLSRHNFILLGLRGQAKSRILRGLTTLLDAVVPYIAGSEIRDNPYKPLSQYS
RDLIAAKGDATPIAWLTPDERYVEKLATPDVTVADLIGDVDPIKAARSGEQLSSELTMHY
GLLPRANRGIFAINEAPDLAGKIQVALFNIMQEGDVQIKGYPVRLQLDVAITFSANPEDY
TARGKIVTPLKDRIGSEIRTHYLDSIEQAIAVTEQEAWSTRSALDIDVPRYIRETVEQIA
FVAREDKRVDKRSGVSQRLPISVMELVISNAERRALTHGETVAVPRIGDIYTSLPGITGK
IELEYEGEMRGADTVVRDIILTAVKRTFDGYFAEANTQQIEQWFNLGGTVQLSDAVSAEQ
SLKELQQIQGLFDKLKPLSLEKRAGNEALVSAAEFLLEGMTAHKRISRNEERSFSASEKQ
TRKERAQNFGEDLRERDDYRNRSKRGFN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaagcattcgctcccgtctgatctgccgcaaacactgggtgaactccgcacc
tccgagtggacctttgagcgtgtcacgcgctccgtgaaagacgagctgcgagaaaacctc
atcgccaagctgcgtgcgaaggagaccatcttccccggcgtcgtcggatatgaagacacg
gtcatcccgcagatcgtgaatgccgtactctcccgccacaacttcatcctgctgggcctg
cgcggtcaggcaaagagccgcatcctgcgcggcctcaccacgctgctcgatgccgtggtt
ccctacatcgcaggctccgagattcgcgacaatccgtacaagccgctctcgcagtactcg
cgcgacctgatcgcagccaagggtgacgcaacccctatcgcatggctcacgcccgatgaa
cgttacgtcgaaaagctcgcaacgcccgacgtcaccgtggccgacctcatcggcgatgtc
gaccccatcaaggcggcacgcagcggcgagcagctctcaagcgaactcaccatgcactac
ggcctgctgccccgcgccaaccgcggcatcttcgccatcaatgaagcgcccgatctcgcc
ggcaagatccaggtcgcacttttcaacatcatgcaggaaggcgacgtgcagattaagggc
taccccgtccgcctgcagctcgatgtcgccatcaccttctccgcaaaccccgaggactac
acggcccgcggcaagatcgtgacaccgctcaaggaccgcatcggctccgagatccgcaca
cactacctcgactccattgagcaggccatcgccgtcaccgagcaggaagcctggtccacc
cgctccgcactcgacatcgacgttccccgctacatccgcgagaccgtcgagcagatcgcc
ttcgtcgcacgcgaagacaagcgcgtcgacaagcgcagcggcgtctcgcagcgcctgccc
atctccgtcatggaactcgtcatctccaacgcagaacgccgcgccctcacccacggcgag
accgtcgccgtgccccgcatcggcgacatctacacctcgctgcccggcatcaccggcaag
atagaactcgagtacgaaggcgagatgcgcggcgccgacaccgtcgtccgcgacatcatc
ctcaccgcagtcaagcgcaccttcgacggctacttcgccgaggccaacacgcagcagatc
gaacagtggttcaacctgggcggcaccgtgcaactctcggacgcagtctctgccgaacag
tcgctcaaagaactgcagcagatccagggactcttcgataagctgaagccgctgtcactc
gaaaagcgcgcaggcaacgaagccctcgtctccgcagcagagttcctcctcgaaggcatg
accgcacacaagcgcatcagccgcaacgaagaacgcagcttcagcgcaagcgaaaagcag
acacgcaaggagcgagcacagaacttcggcgaagacctccgcgaacgagacgactaccgc
aaccgatccaagcgaggcttcaactaa

DBGET integrated database retrieval system