KEGG   Terriglobus roseus: Terro_2798Help
Entry
Terro_2798        CDS       T02140                                 

Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
trs  Terriglobus roseus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Terro_2798
   00051 Fructose and mannose metabolism
    Terro_2798
Enzymes [BR:trs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Terro_2798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3354914..3356236
Genome map
AA seq 440 aa AA seqDB search
MANTVFSNFPAVKFEGADSANPLAYQYYDAERVVMGKPLGEHLRFAVAYWHSFAMSGSDP
FGGATIDRPWMAAGDPIALAKVKADAAFDFFRVLGLPFFCFHDADIAPGGETLKETLGNF
HTIVDYLEEKMASSSTKLLWGTANLFSHPRFMAGASTNPDPDVFAWCAATVKHCMDATKQ
LGGSNYVLWGGREGYETLLNTNMKQELDQMGRFLSLVVDYKHKIGFDGQILIEPKPKEPT
AHQYDFDTATVYGFLKKYGLENEVRVNLEANHATLAGHSFEHEIATAGALGILGSLDINR
GDALLGWDTDQFPNDLWTMTMSMYHVIKAGGLGKGGCNFDAKVRRQSFTEEDLVAAHVGG
VDMCARAFLSAAKLVEEGKYDALLDDRYAGWKTPEAQAMLTGKVSLDEIAAKAESSAINP
QPRSGKQEQIENMLARRIYS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttggctaacactgttttcagcaactttccggcagtgaagtttgagggcgcggacagcgcc
aatcccctggcttaccagtattacgacgcagagcgcgttgtaatgggcaagccgctgggc
gagcatctgcgctttgccgtcgcttactggcacagcttcgcgatgtccggcagcgacccg
tttggtggagcgacgatcgatcggccgtggatggctgcgggcgacccgattgcgctggca
aaggtgaaggcggatgctgcgttcgacttcttccgcgtgcttggacttcccttcttctgc
ttccacgatgcggacattgcgccgggcggcgagacgttgaaggagacgctggggaacttt
cataccatcgtcgattacctggaagagaagatggcgagcagcagcacgaagctgctgtgg
ggcacggcgaacctgttctcgcacccgcgattcatggccggtgcttccacgaaccccgat
ccggatgtctttgcgtggtgcgcggcgaccgtgaagcattgcatggatgcgacgaagcag
ctcggcggatcgaactatgttctgtggggcggtcgtgagggctacgagacgctgctgaac
accaacatgaagcaggagctggaccagatgggccgcttcctgtcgctggtggtggactac
aagcacaagatcggtttcgatggtcagatcctgatcgagccgaagccgaaggagccgacg
gcgcaccaatatgacttcgatacggcgacggtgtatggcttcctgaagaagtacggcctg
gagaacgaggttcgcgtgaaccttgaggcgaaccatgcgacgctggctggtcacagcttc
gagcatgagattgcaacggcgggagcgcttggcatcctgggttcgctggatatcaaccgt
ggcgatgcgctgctgggctgggataccgaccagttcccgaacgacctgtggacgatgacg
atgtcgatgtatcacgtcatcaaggcgggcggcctgggcaagggtggctgcaactttgac
gcgaaggttcgtcgtcagagctttaccgaggaagacctggttgccgctcatgtgggcggt
gtggacatgtgcgctcgtgctttcctttcggctgcgaagctggttgaagagggcaagtac
gatgccctgctggatgaccggtatgcgggctggaagacgcctgaggctcaggcgatgctg
accggcaaggtgtcgttggatgagatcgcagcgaaggcggagtcttcggcgatcaatccg
cagccacgcagtggcaagcaggagcagattgagaatatgcttgcgcgcaggatctactcg
tag

DBGET integrated database retrieval system