KEGG   Terriglobus roseus: Terro_2888Help
Entry
Terro_2888        CDS       T02140                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
trs  Terriglobus roseus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Terro_2888
  Lipid metabolism
   00561 Glycerolipid metabolism
    Terro_2888
   00600 Sphingolipid metabolism
    Terro_2888
Enzymes [BR:trs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Terro_2888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3477138..3479330
Genome map
AA seq 730 aa AA seqDB search
MHIRQLSICLLPFAFAATHLSAQVRAVPDRQQWYLTAGESTYVVGVDEQKMVESLYWGPA
LTPNTLLPAAHSARERASFDGPVNTTPLEYPGWGAGLHLEPSLKIDSPNGDRTLVLQYES
AKADADHLEIVLKDASQPLRVHLHYQVFPEGVLARWSTVENIGTKAFHIEQAASGTLNLP
ANTDYTLSRLTGMWAGEYQLHTDALPFGAQQIESRRGSTGHQANPWFSIGREAKTTETAG
PVWFGELGWSGSWRLDVERTPLNLVRITAGYNPFDFGYNLAPGKSLDTPHLYTGYTNAGN
GEASRILHRFQLAHILPMGPDPKPRPIIFNSWEATEFHVSEEGQVALAEKAAKIGVERFV
MDDGWFGKRKDDHAGLGDWYVDKDKFPNGLKPLIDRVHGLGMSFGLWVEPEMVNPNSDLY
RKHPDWAMHFPDRQRTEQRNQLLLNLAKPEVKAYVLDWLDKLVSENDIAFLKWDYNRNWS
EAGWDGAPAGADEKQIYIAYVQNLYDILEKLRAKHPKLEIESCSGGGGRVDLGILRYTDE
VWPSDNTDAFDRLSIQDGFSHAYTPQVMVAWVTDVPNSLNRRTVPLQYRFLVAMQGALGI
GNDLNKFSDADMALATKLTALYKDVRTTVQHGNLYRLQTPPSNATQVQYVSRDGGQAVLL
AYLHSQQLGLAQPRVQLQGLDPNATYKLQPLDAAKFRGELTATGAQLMGQGLDLHLTGDF
DSTAVVLTRQ
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgcacatccgccaactctcgatttgcctgcttcccttcgcattcgccgctacccaccta
tccgcccaggtacgcgctgtgcccgaccgccagcagtggtatctgactgcgggagagagc
acctatgtcgttggtgtggatgagcagaagatggtcgagagtctgtactggggcccggca
ctcacgccgaatactctcctgcccgccgcgcacagtgccagggaacgcgcatccttcgac
ggcccggtgaacacgacgccgctggagtatccggggtggggtgccggactccatctggaa
ccctccctgaagatcgacagtccgaatggtgaccgcacacttgtgttgcagtacgaatca
gccaaggccgatgcagaccatctggagattgtcctcaaggacgcatcgcagccgctacgc
gtccatctgcactaccaggtcttccctgagggtgtactggcacgctggtcgacggtggag
aatatcggaacgaaggcctttcatatcgagcaggcagcatccggtacgctcaatctgcct
gcaaacaccgattacaccctgagccgactgacggggatgtgggccggcgaatatcagctc
cacaccgatgcactgccctttggtgcccagcagattgagagccgacgcggcagcaccggc
catcaggcgaacccgtggttcagcattggccgggaagcaaagacgaccgagaccgcgggg
ccagtctggttcggagaactgggctggtctggatcgtggcgccttgacgttgagcgcacg
ccgctgaatctcgtgcggatcacggctggttataacccattcgactttggctacaacctc
gctccagggaagtcgctcgatacgcctcacctttacaccgggtacacgaacgcgggcaat
ggggaggcctctcgtattctgcaccgcttccagcttgcccacatcctgccgatgggcccc
gatccgaagccacgtcccatcatcttcaactcatgggaggcaacagaattccatgtcagt
gaagagggccaggtcgcacttgcggagaaggctgcgaagattggcgtcgagcgctttgtg
atggatgatggctggtttggcaagcgcaaggacgaccatgccgggctgggtgactggtat
gtcgataaagacaagttccccaacggcctgaagccactgatcgatcgcgtgcatggactc
ggcatgagctttggcctgtgggtagagccggagatggtgaacccgaactccgatctctat
cgcaagcacccggactgggcgatgcacttcccggatcgtcagcgtaccgaacagcgcaac
cagctgctgctgaacctggccaagcctgaggtgaaggcatacgtgctggactggctggac
aagctcgttagtgagaacgacatcgccttcctcaaatgggactacaaccgcaactggagc
gaagccggttgggacggtgcacccgcaggcgccgacgagaagcagatctacatcgcttat
gtgcagaacctctacgacatcctggaaaagctgcgcgcgaagcatccgaagttggagatt
gagtcctgctccggcgggggaggccgcgtcgatctcggcatcctgcgctacacggatgag
gtctggccgtccgacaacaccgatgcctttgatcgcctgagcattcaggacggcttctcc
cacgcctacacaccgcaggtgatggtcgcctgggtgacggacgttccaaactcgctcaac
cgccgcacggtgccgctgcagtatcgcttcctggtcgcgatgcaaggagcactcggcatc
ggcaacgacctgaacaaattcagcgatgccgacatggcactcgccacgaagctgactgcg
ctctataaggatgttcggacgaccgtgcagcacggcaacctgtaccggctgcaaacgccg
ccgtcgaatgcgacgcaggtgcagtatgtaagccgcgacggtgggcaagcggtgttgctc
gcctacctgcattctcagcagcttggcctggcacagccgcgcgtccagctgcagggtctg
gatccgaatgcgacatataagctgcagccattggacgccgcgaagtttcgcggtgaactg
acagccacgggtgctcagttgatgggtcaaggcctggatctgcacctgacaggagacttc
gacagcaccgcggtcgtcctcacgcgccagtag

DBGET integrated database retrieval system