KEGG   Terriglobus roseus: Terro_2957Help
Entry
Terro_2957        CDS       T02140                                 

Definition
(GenBank) hypothetical protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
trs  Terriglobus roseus
Pathway
trs00010  Glycolysis / Gluconeogenesis
trs00520  Amino sugar and nucleotide sugar metabolism
trs01100  Metabolic pathways
trs01110  Biosynthesis of secondary metabolites
trs01120  Microbial metabolism in diverse environments
trs01130  Biosynthesis of antibiotics
trs01200  Carbon metabolism
Module
trs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Terro_2957
   00520 Amino sugar and nucleotide sugar metabolism
    Terro_2957
Enzymes [BR:trs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Terro_2957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFL89192
UniProt: I3ZIX4
Position
complement(3592717..3593397)
Genome map
AA seq 226 aa AA seqDB search
MKILVVDIGGTHVKVASSDHVVPLKIVSGPGMTAQNMVDQVRTATEGWEYDAISFGYPGP
VAKDGPLAEPHNLAAGWVGFSYAQAFPGKKIRFINDAAMQALGGYRGGRMLFLGIGTGLG
SCLIFDGTIVPLELAHLPYKKGRTYEQYIGLAGLERRGKKAWRKSVLKIVALLRAATVCD
SVLLGGGNAKLMKKLPKGTSCGANSNAIQGGFALWAAPSSFGRAGD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttagttgttgatatcggtggcactcacgtcaaggttgcctcaagcgaccat
gtcgttcccctcaagatcgtctccgggcccgggatgactgctcagaatatggtcgatcag
gtgcgcactgccaccgaaggttgggagtacgacgcgatctcctttggctatccagggccg
gtcgcaaaggacgggcccttggccgaaccccacaaccttgccgccggatgggtaggcttc
tcgtacgcacaagctttccctggcaagaagatccgattcatcaatgatgctgccatgcag
gcacttggcggctaccgcggtggtcggatgctctttcttgggattggtacaggtctcggc
tcctgtctcatctttgacggcaccatcgttcccctcgaactcgctcatctcccatataag
aaaggccgcacctacgagcagtacatcggccttgctggtctggagcggcgtgggaagaag
gcgtggcgcaaatccgtcttgaagattgtcgctctcttacgtgccgctacggtttgtgat
tctgtgctgctcggcggcggcaatgcgaagctgatgaagaaactaccaaaaggcacttcc
tgcggcgcgaatagcaacgcgattcaaggtggcttcgctttatgggccgcgccctcttcc
tttggccgagcaggtgattga

DBGET integrated database retrieval system