KEGG   Terriglobus roseus: Terro_2957Help
Entry
Terro_2957        CDS       T02140                                 

Definition
hypothetical protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
trs  Terriglobus roseus
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:trs01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:trs00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:trs00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3592717..3593397)
Genome map
AA seq 226 aa AA seqDB search
MKILVVDIGGTHVKVASSDHVVPLKIVSGPGMTAQNMVDQVRTATEGWEYDAISFGYPGP
VAKDGPLAEPHNLAAGWVGFSYAQAFPGKKIRFINDAAMQALGGYRGGRMLFLGIGTGLG
SCLIFDGTIVPLELAHLPYKKGRTYEQYIGLAGLERRGKKAWRKSVLKIVALLRAATVCD
SVLLGGGNAKLMKKLPKGTSCGANSNAIQGGFALWAAPSSFGRAGD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttagttgttgatatcggtggcactcacgtcaaggttgcctcaagcgaccat
gtcgttcccctcaagatcgtctccgggcccgggatgactgctcagaatatggtcgatcag
gtgcgcactgccaccgaaggttgggagtacgacgcgatctcctttggctatccagggccg
gtcgcaaaggacgggcccttggccgaaccccacaaccttgccgccggatgggtaggcttc
tcgtacgcacaagctttccctggcaagaagatccgattcatcaatgatgctgccatgcag
gcacttggcggctaccgcggtggtcggatgctctttcttgggattggtacaggtctcggc
tcctgtctcatctttgacggcaccatcgttcccctcgaactcgctcatctcccatataag
aaaggccgcacctacgagcagtacatcggccttgctggtctggagcggcgtgggaagaag
gcgtggcgcaaatccgtcttgaagattgtcgctctcttacgtgccgctacggtttgtgat
tctgtgctgctcggcggcggcaatgcgaagctgatgaagaaactaccaaaaggcacttcc
tgcggcgcgaatagcaacgcgattcaaggtggcttcgctttatgggccgcgccctcttcc
tttggccgagcaggtgattga

DBGET integrated database retrieval system