KEGG   Terriglobus roseus: Terro_3621Help
Entry
Terro_3621        CDS       T02140                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
trs  Terriglobus roseus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:trs01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:trs00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4328018..4329283
Genome map
AA seq 421 aa AA seqDB search
MKLIKTTGRNAKDAYALLATLERRGAVKTAEVEPTVRKIMQEVQKKGDKALLKFAEKFDS
LQGHLRVTAGEMLDAWNATPEPLQQAMQIAAENIRSFAEQQKPDEWTTENTPGVTVGQII
RPLESVGCYVPGGRYPLPSTLLMTTIPAKVAGVERIVVCSPKPARETLAAAHLAGVTEMY
RTGGAQAIAAMAYGTETIARVAKIVGPGNLYVTAAKIIASTECGIDMPAGPTEIVVTSQV
GDAAGIAADLVAQAEHDPETLAVLVTADSQLAKQVVNEVKEQAKNNKLAQVSIKARGTIF
LCGSVEEARFITNRLAPEHLTVDSVEDLAWVKNAGSVFIGNYSPQSMGDYISGPNHVLPT
GRVGRMRGGLSIYDFLKVITVQNYTAAGLAKLGPHAIALAEAEGLTAHAQSVRVRMKAGK
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcatcaagaccacaggccgcaacgcgaaagacgcctacgcactcctcgcaacg
ctcgagcgccgcggcgccgtgaagacggcggaagtcgaacccaccgtccgcaagatcatg
caggaagtccagaagaagggcgacaaggctctgctgaaattcgcagagaagttcgactcc
ctgcagggccacctccgcgtcaccgccggcgagatgctcgacgcatggaacgccacacct
gaaccactgcagcaggccatgcagatcgccgcggagaacatccgcagcttcgctgagcag
cagaagcccgacgagtggaccacggagaacacgcccggcgtcaccgtcggacagatcatc
cgtccgctcgagtccgtcggctgctacgtccccggcggccgctatcccctgccctccacg
ctgctgatgaccaccattccagcgaaggtcgcgggcgtagaacgcatcgtcgtctgcagc
cccaagccagcgcgtgagacgctcgccgccgcacacctcgccggcgtcaccgaaatgtac
cgcaccggcggcgcacaggcgatcgccgccatggcttacggcacggagacgatcgcgcgc
gtcgccaagatcgtcggccccggtaacctctacgtcaccgccgcaaagatcatcgcaagc
accgagtgcggcatcgacatgcccgccggcccgaccgagatcgtcgtcaccagccaggtt
ggcgatgccgccggcatcgcagccgacctcgtcgcacaggccgagcacgatcccgaaaca
cttgccgtcctcgtcaccgccgactcgcaacttgcgaagcaggtcgtgaacgaagtgaag
gagcaggcgaagaacaacaagctggcgcaggtctccatcaaggcacgcggcaccatcttc
ctctgcggctccgtcgaagaggcacgcttcatcaccaaccgcctcgcacccgagcacctc
accgtcgactccgtcgaagacctcgcttgggtcaaaaacgcgggctctgtcttcatcggc
aactactcgccgcaaagcatgggcgactacatcagcggacccaaccacgtgctgcccacc
ggccgcgtcgggcgcatgcgcggcggcctcagcatctacgacttcctgaaggtcatcacc
gtgcagaactacacggcagcaggcctcgcaaagctcggaccacacgccatcgcactcgcg
gaagccgagggcctcaccgcccacgcccaaagcgtccgcgtccgcatgaaagcaggcaag
cgatga

DBGET integrated database retrieval system