KEGG   Terriglobus roseus: Terro_3679Help
Entry
Terro_3679        CDS       T02140                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
trs  Terriglobus roseus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Terro_3679
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Terro_3679
Enzymes [BR:trs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Terro_3679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4388980..4389519
Genome map
AA seq 179 aa AA seqDB search
MMLLLLCSSLAAYAGTAKEVYKYPLKTIDGEKTSLAPYKGKVLMVVNVASACGYTPQYAA
LESVYEKYKDKGLVIVGVPANNFGGQESGTEAEIKTFCNRKYHVTFPMMSKVSVLGADKT
PLYQYLTDKTTDPNFSGEIKWNFTKFLIGRDGQPVNRFEPATKPDSPEVIAAIEGALKK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgttgttgctttgctcgagcctggcggcgtatgccgggacggccaaggaagtt
tataagtacccgctgaagacgatcgatggcgagaagacttcgctggcgccttataagggt
aaggtcctgatggtcgtgaatgtggcgagtgcgtgcggctacacgccgcagtatgctgcg
ctggaatcggtctatgagaagtacaaggacaagggtctggtgattgtcggcgtgccggcg
aataacttcggcgggcaggagtcgggtaccgaggcggagatcaagaccttctgcaatcgg
aagtatcacgtgacgtttccgatgatgtcgaaggtatcggtgctgggtgcggacaagacg
ccgctgtaccagtacctgacggacaagacgacggatcctaactttagcggtgagatcaag
tggaacttcaccaagttcctgattggccgggatggtcagccggtgaaccggtttgagccg
gcgaccaagccggattcgccggaggtaattgcggcgattgagggtgcgttgaagaagtaa

DBGET integrated database retrieval system