KEGG   Terriglobus roseus: Terro_3803Help
Entry
Terro_3803        CDS       T02140                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
trs  Terriglobus roseus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Terro_3803
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Terro_3803
Enzymes [BR:trs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Terro_3803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4523061..4525178
Genome map
AA seq 705 aa AA seqDB search
MLSYRPQMWCSAGVILASSLVSALAQSAVTASPNPPSLPKQATLAVLPMPSHVTAGTGQF
VFDRGFDVVLSGYQEPRLDRARMRFLQHLRRKTGILQWPQASGLPQIVVETKSSSAAVQQ
VSEDESYRIDVTPMKIVLTAANPIGALRGLQTILQLIHTTPQGFAIAAMQIEDKPRFPWR
GLMIDSGRHFITPDVIRQTLDGMELVKMNVLHWHLADDQGFRVESKVFPRLQGMGSDGQF
YTQEEVRSIVAYARDRGIRVLPEFEMPSHASSWFVGYPELGDSKGPYRLKHALGQSWERP
RDAAEDSSMDPTQESTYKFLDRFVGEMSSLFPDIYFHIGGDAEDAMIEWKTNPRMKQYMD
AHGMKDPAALQTYFDQRVEKLIAKHGKRMMGWDEVLQPDTPKSVAIQSWRGLDSLAKSAA
SGHPAVLSWGYYLDLNEPASRHYAVDPLADAAGALPEAQRANILGGEAAMWSEYVTAETI
SGRLWPRAAAVAERLWSPREVSDSASMYRRLDTIAQELTYAGVPYVAARASAYDRLTTTV
PAAALNVLASVVEPPRGYPRGGSRTYDSFSPLNRLSDVVPAESDLGREFCAVAGRIASHS
ANAEDLKDAQKWLEQWRDNDTLLAPGLGQSALTAELVPLSKNLSRVASIGLAALERMNHP
GASAADAETFKKNQLAALKTASAQTAELNFAITPGVEALVSAIQR
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
ttgctttcctatcgaccgcagatgtggtgttccgcaggcgtcatcctggcgtcgtccctg
gtttccgcgctggcgcaaagcgctgtaacggcctcgccgaacccgcccagtcttccgaaa
caagcaacgctggcagttctgcccatgccctcccacgtcaccgccgggaccggccagttc
gtctttgatcgcggctttgacgtggtactgtcgggctaccaggagccgcgtctcgatcgg
gcgcgcatgcgcttcctccagcacctccgacggaagaccgggattcttcagtggccccag
gcttctggcctaccgcaaatcgtggtggagacgaagtcttccagtgcggccgtgcagcag
gtctctgaggacgagtcttaccggatcgatgtgacgccgatgaagatcgtgctcaccgct
gccaaccctatcggtgcgttgcgcggactgcagacgatcctgcagttgatccacaccacg
ccgcaggggttcgcgattgctgcgatgcagattgaggacaagcctcgattcccatggcgc
ggcctgatgatcgattccggacggcacttcatcacgcccgatgtgatccgtcagacgctc
gatggcatggaactggtgaagatgaacgtgctgcactggcatctggcagatgaccagggc
tttcgcgttgagagcaaggtcttccctcgcctgcagggcatgggatcggacggccagttc
tacacgcaggaggaagtgcgcagcatcgtcgcctacgcgcgcgaccgcggcatccgcgtg
ctgcccgaatttgagatgccgagccatgcaagctcatggttcgtgggctatcccgagctt
ggtgacagcaaggggccataccgtctgaagcatgcgctcggtcagtcctgggagagaccg
cgcgacgctgccgaggattcctcgatggacccaacgcaggagtcgacgtataagtttctg
gatcgcttcgtcggcgaaatgagttccctcttcccggatatctacttccacattggcggc
gatgcggaagacgccatgatcgaatggaagaccaatccccgcatgaagcagtacatggat
gcgcatggcatgaaggatcctgcagcgttgcagacctacttcgaccagcgcgttgaaaag
ctcattgcgaagcatggcaagcgcatgatgggctgggatgaggtcttgcaaccagacacg
ccgaagagcgttgcgattcaatcgtggcgcgggctggactccctcgcgaagtctgcagca
agtggacaccctgccgtactgtcgtggggctattatctggatctgaacgaaccagcctcg
cgtcactacgcggtcgatccgctggcggatgcggcaggcgccttaccggaagcgcagcgt
gccaacattctcggcggtgaggccgcgatgtggtcagagtacgtaacagcggaaacaatt
agcgggcgtctgtggccgcgtgctgcggcggtagcggagcgcctctggtcaccgcgagaa
gtaagcgatagcgcatcgatgtacaggcgtctggacacgatcgcgcaggagctcacctac
gctggtgtgccttatgttgccgctcgcgcgagcgcctatgaccgcttaaccacaactgtt
cccgctgccgcattaaacgtactggcaagtgtcgttgagccgccaagagggtacccgcga
ggtggcagcagaacctatgactctttctcaccgttgaatcgtctgtccgatgttgtccct
gccgagagcgatctggggcgagagttctgtgcggtagctggtcgcatcgcgtctcactca
gcgaatgccgaggatctgaaagacgcacagaagtggctggagcagtggcgtgacaacgat
accctgcttgcgccgggcctcgggcaatcggcattaacggctgagttggtcccgctgtcg
aagaacctgagccgtgttgcatcgatcggtctggctgcgctggaacgtatgaatcatccg
ggcgcgagcgctgcggatgcagagacctttaagaagaatcaactggccgcattgaagacg
gccagtgcacagacggcagagcttaatttcgcgatcacgcctggggtcgaggcattggtt
tccgcgattcaacgataa

DBGET integrated database retrieval system