KEGG   Terriglobus roseus: Terro_4118Help
Entry
Terro_4118        CDS       T02140                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
trs  Terriglobus roseus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Terro_4118
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Terro_4118
Enzymes [BR:trs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Terro_4118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4888337..4889311
Genome map
AA seq 324 aa AA seqDB search
MSPTAANPHVSHPGSLLSIHDISLEQISSLLALANDLEAMPHRERMGRLDGRKVALLFYE
SSTRTRTSFELAAKSLGAMTTLVSDKSSSIEKGESLHDTGVTLRALGAEAIILRSNYSGA
PEVLARCTGLPVLNAGDGMHEHPSQALLDLRTMLKRLGLSESLTANTLNGVTVAITGDVR
HSRVARSNAMLLPRLGARVILCGPPELCPVEALSVTPGVEIERDFEKALSQATVAMMLRI
QRERLAGLDIDTGEYIAGYQLNAERLARTAPKVLVMHPGPMVRGLEIDSAVADGPQSAIE
EQVTHGLAIRMALLDRALRPETNA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagccccactgctgccaatccgcacgtctctcaccccggttccctgctttccattcac
gacatttccctggagcagatcagcagcctgctggcgctggcgaacgacctggaggcgatg
ccgcaccgtgagcgcatgggccggctggatggccgcaaggtcgcgctgctgttctacgaa
tcgtcgacgcgtacgcgaacttcatttgagctggcggcgaagtcgctgggcgcgatgacg
acgctggtcagcgacaagtcctcttccattgaaaagggtgaaagcctgcatgacacaggg
gtaacgctgcgtgcgctgggtgccgaggcgatcatcctgcggtcaaactacagcggcgca
cccgaggtgctggcgcgctgcaccggtctgccggtattgaatgctggcgacggcatgcat
gagcatccgtcacaggcgctgctggatctgcgcacgatgctgaagcggctggggctttcg
gagtcgttgacggccaatactttgaacggcgtgacagtcgcgattacgggcgatgtgcgg
cactcgcgtgtggcacggtcgaatgcgatgctgctgccgcggcttggcgcgcgcgtgatc
ctgtgtggaccgccggagctttgccctgtagaagcgttgtcggtgactccgggtgttgag
atcgagcgcgactttgagaaggctctctcacaggcgaccgtggccatgatgctgcgcatt
cagcgcgagcggctggcaggcctggacattgatacgggcgagtacatcgcgggctatcaa
ttaaacgcggagcggctggcgcgaacggcaccgaaggttctggtgatgcatcccgggccg
atggtgcgtggacttgagattgattctgcagtggccgatggcccgcagtcggccattgaa
gagcaggtcacgcacggcctggccatacggatggcgctgctggaccgtgccctgcgaccg
gagacaaacgcatga

DBGET integrated database retrieval system