KEGG   Terriglobus roseus: Terro_4324Help
Entry
Terro_4324        CDS       T02140                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
trs  Terriglobus roseus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Terro_4324
Enzymes [BR:trs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Terro_4324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5136070..5136972)
Genome map
AA seq 300 aa AA seqDB search
MRTIVVVGSLNMDMVSTVDRMPAPGETVAGRGFAMVHGGKGANQAVAAARLGAVVRMVGC
VGSDSFGGLLRQGLVAEGIDVAGVRECPGASGVAAITVDGSGGNSIVVYAGANALLLPGM
IDAASIDSAAMVLVQLETPMATVVRLAEVCSAAGTPLMLDPAPAQALSVSLLRKTAWLTP
NESEARTLLGVAEDLPMEEAAERLLALGVRNVMLKLGARGVYLAGADVASTLVPAPAVRA
VDTTAAGDCFNAAFAVALTEGQAPVAAARFACAAAALSTTGAGAQPSMPTREAVLRMMRG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgatcgttgttgtcggcagcctgaatatggatatggtcagcacggtggaccgt
atgcctgcgccgggtgagacggtggccgggcgcggctttgcgatggtgcatggtggcaag
ggtgcgaaccaggcggtggccgcggcacggctgggcgctgtggtgcggatggttgggtgt
gtcgggtcggatagctttggcggcttgctgcggcaggggctggttgcggagggtatcgac
gttgctggtgtgagggagtgtcccggcgcgagtggcgtggctgcgatcacggtcgatggg
agtggtggcaatagcattgttgtctacgcgggtgcgaatgcgctgctgctgcccgggatg
atcgacgcggcatcgatcgattcagcggcgatggtgctggtgcagttggagacgccgatg
gcgacggtggtgcggctggcggaggtctgctctgctgcgggtacgccgctgatgctggat
cctgcgccggcccaggcgctgtctgtctcgttactgcggaagactgcatggcttacgccg
aatgagtcggaggctcggacgctgcttggcgttgcggaggatcttccgatggaagaggct
gccgagcggctgctggcgctgggtgtgcgcaatgtgatgttgaagcttggggcgcggggt
gtctatcttgcaggagctgacgttgcgagcacgctggttcctgcgccggcggtgcgggcc
gtggatactacggccgcaggggattgcttcaatgcagcctttgccgtggcgctgacggag
gggcaggcgccggttgctgctgctcgctttgcgtgtgctgctgctgcgctttcgacgacg
ggagcgggggcgcagccgtcgatgccgacgcgcgaggctgtgctgcggatgatgcgcggc
tag

DBGET integrated database retrieval system