KEGG   Takifugu rubripes (torafugu): 100137506Help
Entry
100137506         CDS       T02386                                 

Gene name
cpa1
Definition
pancreatic carboxypeptidase A1 (EC:3.4.17.1)
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 452 aa AA seqDB search
MRGLLVFATLFVAALCRETFVGDKVLRIIPKNEAQLSFLKSMEDMPEIDVWRGVTEVGIP
VDVRVPVQHLPVVKVHLQSQDIQHSTMIEDLQVLLDEEQEGMESAARFAEPRNTDSFDYS
NYHTLSELHQNCVGAEPDSQTVASFQIYSFQDMLVAENPSLVSKIVIGQSYQGRALNVLK
VREAGFLISSVRTEFSTGGSKRPAIWIDTGIHSREWVTQASGTWFAKKIVTDYGKDPALT
AILNKMDIFLEIVTNPDGFYYTHNNNRMWRKTRKPNPGSSCVGVDPNRNWDAGFGGPGAS
GSPCSETYRGTRAHSESEVKSIVDFVKAHGNIKAFISIHSYSQMLLYPYGYTRTPVKEQA
ELHSLAKKAITDLASLYGTYYRYGSIINTIYQASGGTIDWTYNQGIKYSYTFELRDTGRY
GFILPANQILPTARETWLALMTIMNHTFKNPY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagggggttactggtgttcgccacgctcttcgtcgctgctctctgcagggagacattt
gtgggagataaagtgctgcgtattattccaaagaatgaggctcagctctcctttctcaag
agcatggaggacatgcccgagattgacgtctggaggggagtgacagaagtgggaattcct
gtggatgtcagagttcccgtccagcacctgcctgtggttaaagtccacctgcagagccag
gacatccaacactccaccatgatcgaggacttgcaggtgctgctggacgaggagcaggag
gggatggagtcggctgctcgtttcgctgagccgaggaacaccgacagcttcgactactcc
aactatcacaccctgagcgagctccatcagaactgcgttggggctgaacctgattcacaa
actgtggcttcgtttcagatctacagtttccaggacatgctggtggctgagaatcccagc
ctggtcagcaagattgtgatcggtcagagctaccagggccgcgccctgaatgtgctgaag
gtgcgcgaagcaggattcttgatatcgagtgttcgcacggagttcagcaccggtggaagc
aaacgtcccgctatctggatcgacactggaatccactccagggagtgggtgactcaggct
agcggcacctggttcgctaaaaagattgtgaccgattacgggaaagatccggctctcact
gccatcctgaacaagatggacatcttcctggagattgtaaccaaccctgatggcttctac
tacacccacaacaacaaccgtatgtggcgtaagaccaggaagcccaaccctggatccagc
tgtgtgggagtcgaccccaacagaaactgggatgctggttttggaggacccggcgcaagt
ggcagcccctgctcagagacctaccgtggaaccagagctcactcggagagtgaagtcaaa
tccatcgtggattttgtgaaggctcacggtaacatcaaggcattcatctccatccattcc
tactcccagatgctgctgtacccttacggctacaccagaactccagtgaaggaacaggct
gagctgcatagcctggctaagaaagctattactgacctggcctccctgtacggtacttac
tacagatacggcagcatcatcaataccatctaccaagctagtgggggaaccattgactgg
acttacaaccaagggatcaagtactcctacacctttgagctgagggacactggtcgctat
ggcttcatcctgccggccaatcagatcctccccacagccagggagacttggctggctctc
atgaccatcatgaatcacaccttcaagaacccctattaa

DBGET integrated database retrieval system