KEGG   Takifugu rubripes (torafugu): 101061215Help
Entry
101061215         CDS       T02386                                 

Definition
intestinal-type alkaline phosphatase 1-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101061215
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101061215
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101061215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 524 aa AA seqDB search
MASRQKMIVTGLILFISIQWTSSAPERDLRELRTDFWYNKGRQALFTAMNVQPNIKKAKN
MILFIGDGMGVPTVTAARMLKGQLGGRTGEEADLVMDTFPHLALSKTYNVDKQMPDSAGT
ATAYLCGVKANYGTLGVNAATPRYDCNATFGNEVTSVLHRAKKAGKSVGIVTTTRVQHAS
PGASYAHIANRGWYADSDLSPEAVAGGCRDIAHQLVYNTEIDVILGGGRQYMYPKTMQDP
EYPASRGSREDGRNLILEWVKDKTNVKYVWEKSEFDSVNPSHTDFLMGLFEPKDCRYELD
RDPKMDPSLTEMTEKAIQILSKNPKGFFLFVEDNGRIDHAHHGGKAKRALYETVEFDQAI
GRAAELTSELDTLTVVSADHSHVFAFGGDSPRGNPVLGVSSLLAEDKKHFTTAVYGNGPG
YQIANGTRPDVNETISSDKDYRQQAAVPLDSETHGMDDVAIYAKGPMSHLFHGVQEQSYI
AHVLAYAACIEPYDDCNLPNHAGSIHPSLQLLLLAASLFSLCSL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggccagccgacagaagatgattgttactggattaattcttttcatttccattcagtgg
acttcttctgctccagaaagagacttgcgtgagctccgtaccgacttctggtacaacaaa
ggcagacaggcacttttcacggccatgaatgttcagccaaacatcaaaaaggcaaagaac
atgatcctcttcataggagatggtatgggagtgccgacagtaaccgctgcacggatgctc
aaaggccagttgggaggaagaaccggtgaggaagctgatctggttatggataccttccca
cacttggccctgtctaagacatacaatgtggacaagcagatgcctgacagcgccggcaca
gccacggcttacctttgtggcgtgaaggccaactacggaaccctgggtgtcaacgccgcc
actccaaggtacgactgcaacgctacctttggcaacgaggtcacctcggtcctgcaccgc
gccaagaaagcagggaagtcggtggggattgtcacgacaaccagagtgcagcacgcgtcc
cctggagccagctacgcgcacatcgccaaccgcggctggtatgccgactccgacctctct
cctgaagcggtcgcaggcggctgccgcgacatcgcccaccagctggtttacaacacagag
atcgacgtcatcctcggaggaggccgtcagtacatgtaccctaaaaccatgcaagatcca
gaatacccagcttccagaggatcccgggaagacgggaggaacctaattttggaatgggtg
aaggacaaaacgaacgttaaatatgtttgggaaaagtctgagtttgacagcgtcaatccc
agtcacacagacttcctaatgggtctcttcgagcccaaagactgccgctacgagctggac
cgcgatccaaaaatggatccttcccttacagagatgacggaaaaagcaattcagattctc
agcaagaacccgaagggattttttctttttgtggaagataatggcagaattgaccacgct
caccatggagggaaggccaaaagagccctctatgagaccgtcgagtttgaccaagcgatc
gggcgagcggctgaacttaccagcgagctggacactctcactgtggtctccgctgaccac
tcccatgtgttcgcatttggaggagactcccccagaggaaacccagttttaggcgtgtct
tctttactggctgaggacaagaagcacttcacaactgctgtttatggaaacggaccaggg
tatcagatcgccaatggaactcgtccagacgtaaatgagacaatttcatcggataaggat
taccgtcagcaggctgccgtccctctggattcggagacccacggcatggatgatgtagcc
atctatgccaaaggtcccatgtcacaccttttccatggagttcaggagcagagctacata
gctcatgtgctggcttatgcagcttgcattgagccttacgacgactgcaatttgcccaac
cacgcgggatccatccaccccagtctgcagcttctactactggccgcctcgctcttctcc
ctctgctctctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system