KEGG   Takifugu rubripes (torafugu): 101061250Help
Entry
101061250         CDS       T02386                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 249 aa AA seqDB search
MRVAFRLVVAAIPMGLLLSRAMAWMSSGSTHAELITRLRDHGVIRSDRVFNAMLATDRGI
YSADHPYADSPQPIGYRATISAPHMHAHALELLSVKLTEGAAALDVGSGSGYLTACFARM
TGPTGRVVGVEHISQLVEMSIKNVQADDPELLTSGRIRLVVGDGRQGFPEGAPYDAIHVG
AAAPSVPKSLLAQLKPGGRLILPVGPTSGSQMLMQYDQQRDGTFITKALMGVMYVPLTDR
RHQWPGEEL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtagctttccggctggtagtagcggcaattcctatgggcttgctgctgtcccgg
gcaatggcgtggatgtccagcggcagtactcatgcagagcttatcaccaggctgagagat
catggggtgatccgaagtgaccgagtctttaatgcgatgctggctacagacagagggatt
tactctgcagaccatccttatgcagactctcctcagcctataggttacagagcaaccatc
agtgcaccgcacatgcatgctcatgctttggagctgttgagtgtcaaattaacggaaggg
gcagctgctctagatgtgggttcaggaagtggctatctcactgcctgctttgcaaggatg
acgggacccacgggaagggtggttggtgttgaacacatcagccaactggttgaaatgtca
ataaaaaatgtgcaagctgatgacccagaactactcacctctggtagaattaggcttgtc
gtgggagacggaaggcagggtttccctgagggagcgccatacgatgccattcatgttggc
gctgctgcacctagtgtccctaaatctctcttggcacagcttaagcccgggggccgcctg
attctgccagtgggtcctactagcggcagtcagatgctcatgcagtacgatcagcagagg
gatggcacgtttatcacgaaagctctgatgggagtgatgtatgttccacttactgacagg
aggcatcagtggcctggagaagagctgtga

DBGET integrated database retrieval system