KEGG   Takifugu rubripes (torafugu): 101061256Help
Entry
101061256         CDS       T02386                                 

Definition
(RefSeq) cGMP-dependent protein kinase 1-like
  KO
K07376  
cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Vascular smooth muscle contraction
Gap junction
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    101061256
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    101061256
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     101061256
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   101061256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 684 aa AA seqDB search
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQV
HKQTELQEQQRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNL
ELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESLKLCTMGPGKVFG
ELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKQTEYMEFLKSVPTFQGLQE
DILSKLADVLEETHYEDGEYIIRQGARGDTFFIISKGKVNVTREDSPSGEPVYLRSLGKG
DWFGEKALQGEDIRTANVIAAEAVTCLVIDRDSFKHLIGGLEEVSSKGHEDADAKAKYEA
ENAFFFNLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIR
SEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTAC
VVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAP
EIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNA
ANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPTVTSAVDIS
NFDNFPEDKEDPPPDDNSGWDVDF
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccttgcgcgacctccaatacgcgctccaggagaagattgaggagctgcgccag
agggacgcgctgatcgacgaactggaactggagctagaccagaaggacgagctcatccag
agactgcaaaacgagctggacaaataccgctccgtcatcaaacccgcaacccaacaggtc
cacaagcagacggagctgcaggagcagcagaggacgaagagacaggcaatctcggctgag
cccactgcctttgacatccaggatctcagccatgtcaccctacctttctaccccaagagt
ccacagtccaaggatctgatcaaggaggccatcttggacaacgacttcatgaagaacctg
gagctgtcccagatccaagagattgtggactgcatgtatcctgtggagtatggaaaagac
agctgcatcatcaaggaaggcgacgtgggctcgctggtctacgtcatggaagacgggaag
gtggaggtgacgaaggagagcctgaaactttgcaccatggggcccgggaaggtgttcggg
gagctggctattctctacaactgcaccaggaccgccactgtcaagactcttacaaatgtg
aagctgtgggccatcgaccggcagtgtttccagaccatcatgatgaggaccgggctcatc
aagcagaccgagtacatggagtttttgaaaagcgtccccacgttccaaggcctgcaggaa
gacattctgagcaagcttgcagatgtccttgaggagacacattacgaagatggagagtac
atcattagacagggagccagaggagacaccttcttcatcatcagtaaaggaaaggttaat
gtgacgagggaagactcgcccagcggagagcccgtctacctgcggagcctcgggaaagga
gactggttcggagagaaagctctgcaaggggaggacatcaggacggccaacgtcatcgcg
gcagaggcggtcacctgtctggtcatcgacagagattctttcaagcacctgattggaggt
ttagaggaagtatccagcaaaggccacgaggacgctgacgccaaagccaagtatgaagca
gagaacgcctttttcttcaacctcaacctggccgacttcaacatcatcgacactctgggg
gttggaggctttggccgcgtcgagctggttcagctcaagagcgacgaaaacaaaaccttt
gccatgaagatcctgaaaaagcggcacatagtggacacgagacagcaggagcacattcgt
tcggagaaactcatcatgcaggaggcccactctgatttcatcgttaggctgtatcgaaca
tttaaggacagcaagtacctctatatgctgatggaagcttgcttaggaggagagctctgg
accatcctccgagatcggggctcctttgaggactccacgaccaggttttacacagcttgt
gtggtggaggccttcgcctacctgcattccaaaggaatcatctacagagacctcaaacca
gagaaccttatactggaccacaggggctatgctaaactggtcgactttggctttgcgaag
aagatcgggtttgggaagaagacgtggaccttctgcgggacgccggagtatgtagcacca
gagatcatcttgaacaaaggccacgacatctcagccgactactggtccctgggaatcctc
atgtttgagctcttaactggcagccctccgttctctggccccgatccgatgaaaacctac
aacatcatcctgagaggtattgacatgattgaattcccaaagaaaattaccaaaaatgct
gccaaccttatcaaaaagctatgcagggataatccttcggaaagactaggaaacttgaaa
aatggtgtcaaagacatccaaaagcacaaatggtttgagggctttaactgggagggactg
aagaaggggacgctgacacctcccatcatccctaccgtcacatcagcagtcgacataagc
aactttgacaacttcccagaggacaaggaagacccgcccccggacgacaactctggctgg
gacgtggatttttga

DBGET integrated database retrieval system