KEGG   Takifugu rubripes (torafugu): 101061400Help
Entry
101061400         CDS       T02386                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101061400
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101061400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 312 aa AA seqDB search
MTEKAFDVMVVGSCMTDMVSQTPRLPKAGETIHGFKFFIGFGGKGANQCIQAARLGARTT
MVCKVGKDVFGDNYIQNFKDNGVHTDFVGQTPDAATGTASIIVNNAGENAIVIVAGANML
LDSVDLQEALPAITRSKVLVCQLEINPQISLQALRMAQKNKVKTIFNPAPASPDLDPEFY
TASDVFCCNESEAEMLTGSVVTNVEEARGAAQELLKRGCKSVIITLGPQGCVVVQAQEST
SKHVPTTAVKAIDTTGAGDSFIGALAFYMAHYPTMALEEMTYRANQVAGVSVQAVGTQTS
FPIRAGLPADLF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaggcatttgatgtgatggtggttggctcttgtatgactgacatggtgagt
cagactccaaggctacctaaagctggggaaaccattcatggctttaagttcttcattggc
ttcggagggaaaggggccaaccagtgcatacaagctgcaagactgggggctagaaccacc
atggtgtgcaaggttggtaaagatgtctttggagacaattacatccagaattttaaggac
aatggtgtacacacagactttgttggacagacccctgatgccgcaacaggaactgcatcc
atcattgttaataatgcaggtgagaatgccattgtgattgtggctggtgccaacatgctg
ctggacagtgtagatctgcaggaagctcttccagccataactcgttcaaaagttttagtg
tgccagctagagatcaacccgcagatatccttgcaggcactacgtatggctcagaagaac
aaagtaaagacaatattcaacccagctccggccagtcctgacttggatccagagttctac
acagcttctgatgtgttttgctgtaatgaatctgaggctgaaatgctgactggatctgtg
gtaactaatgtggaagaagcacgtggagctgctcaggagttgctgaaacgaggctgtaag
tcagtcatcatcactttgggacctcaaggctgcgtcgtggtccaggcacaagagtctacc
tccaaacacgttccaactactgccgtgaaagcaatagacaccactggtgctggagacagc
tttattggagcactggcattttacatggctcattatccaacaatggctcttgaagagatg
acctacagagccaatcaggtggcaggagtcagcgtgcaggctgttggaacacaaacttca
tttcccatcagagcaggccttccagctgatctgttttag

DBGET integrated database retrieval system