KEGG   Takifugu rubripes (torafugu): 101061410Help
Entry
101061410         CDS       T02386                                 

Gene name
lamc3
Definition
(RefSeq) laminin, gamma 3
  KO
K06247  
laminin, gamma 3
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101061410 (lamc3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    101061410 (lamc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1574 aa AA seqDB search
MAPSFPLVFCLVHFVGWYQLLTPSLLFWISLPVWEGVRDYVREAEILHQPAREFRHLQAH
PGGRTLAALPVLQCFVQEDLWEAGKCLHPPRRRREKCPLHGRVQRHLSPHWRKRGVLHSG
GTAQRVQLRPKLVAADAVSPQNLPSHQPLHAECCDIPGNLLRSRKKLAFLLTDPILNWEK
KEWVTATDLLISLDRLNTFGDEFFKDPKVLRSYFYGISDFSVGGRCKCNGHASECSEGEQ
GRLLCVCQHHTAGDDCQRCHPFYQDRPWARATGDSANECLICNCSGRSDQCVFDAEQYRS
TGSGGRCLSCRDLTDGPHCERCRENHYRTSAEEPCLPCICNINGSVSLQCDAEGKCACRT
GVTGEKCDKCAAGFHSLGPAGCRPCECDPSGSVGDCSPSDGGCDCKANVEGQSCGRCKPG
FYNLRGVNPEGCQACFCFGHSLACSSSSHHVVANITSDFLEDQDGWLGEFFGGQSYPLLW
KEGEVYLLPLSEDDIGFYKAPEKFLGRQVYSYGQLLTITFTSETAELLPNNVTLLLQGSD
ATLTAELSPQPLFSRDPDLTPRRSFEIRLHEQEGFEPALSAFEFQTFLYNLTDLRISNAG
GRNYTSQLTSVTLISAAISDKLSGPHARWVESCTCPPGFAGQFCEQCAPGFTRQDPGGGP
LSPCVPCNCHQHGTCHQETGVCNCSDFTAGKACERCLEGYYGNALIGMPGDCQPCPCPDQ
SSCAQIVSTGQVVCTNCPRGQTGMRCQLCEDGYYGDPLGRSGAARPCERCDCNGNVDPNA
LGVCDHASGRCLKCLGHTEGHHCERCQRGFYGDALDPTAGKKCKPCSCHPAGTSGDVSEC
HPQTGRCRCLAHVTGRVCASCEVGFFNLQPGVGCERCQCNPVGSSSPACHPITGQCVCRA
GVEGTLCHTCRTGFFGFSSRGCRACNCDPMGSVSMQCHNNGTCRCRRGFVGYKCDKCELN
YFHNRATHQCEECPVCYGLVQKQAEKLRNRLQDLENLLARFDCRSRSGRHLPYPRRPAAE
QQREESLPNALEDFLAFQEAREAFIKQFSSLEASTGRLVAQLHGVTSALNCSLAVTEGGS
TRSEASGKAEGVCQSFTEAALVIRRAQKQLQQATLDLDNMVIPFEMGSEPNQWNMMVNES
QVLLQSRRDTAEHIGVVAGSAVNASKQALGLLMGLLQDNSTEEYIGNLTERIAEMQEQTE
TLAEQTDAAVAEQLTLEAEAGALRRALANVTSSLHRLLPTEAIPDQTNRTGHTNSTGGRA
DELLRQTAELHLRLQARDELLVQMEEERRPLEQAARDKEEVLDVASELQARTHEAKVVAL
ASVVEGKDVESSAMLLRRQLEDMVSEWPRRRAQTQSALKKERPLENKILASIEKRVSHIQ
EMLEPAAENSSVSRKVAKEAAETADAVAKESKDVLTQAKHARTASAHLGSHIDSALQRLV
EQEALTGAAHSQITEPKVSLGAVKEDMEAARLELAAYSDTLTQLINKIDESVPLERFDRI
LNETARRLRMLRGSVESPHLGRKIQKLHLAAEEQRSQMSLIDQDLQDIREERDSLRDIAS
NLPRACPSAEAARG
NT seq 4725 nt NT seq  +upstreamnt  +downstreamnt
atggcacccagctttccccttgtgttctgtttagttcattttgttggttggtaccaactc
ctgactcccagtctgctgttctggatttctctgcctgtttgggaaggcgttcgagattac
gtacgtgaggctgaaattctacaccagccggccagagagtttcgccatctacaagcgcac
ccaggaggaaggaccctggctgccttaccagtattacagtgcttcgtgcaagaagaccta
tgggaagcaggcaaatgcttacatccgcccaggagacgacgagagaagtgccctttgcac
ggacgagttcagcgacatctctcccctcactggaggaaacgtggcgttctccactctgga
gggacggcccagcgcgtacaacttcgaccaaagcttgttgctgcagatgctgtctcccca
caaaacctcccctctcatcaacctctgcacgctgagtgctgtgacatccctgggaacctc
ctacggagtagaaagaagctcgccttcctcttgactgatcccattttaaattgggaaaag
aaggaatgggtgacggcaactgacctcctcatctccctggacaggctcaacaccttcggg
gacgagttcttcaaggaccccaaagtgttgcgctcctacttctatggcatctctgatttc
tcggtggggggcaggtgtaagtgcaacggccacgctagcgagtgctccgagggcgagcag
gggaggctgctctgcgtctgccagcatcatacagcgggggacgactgccagagatgtcac
cccttctaccaggacagaccctgggccagggccaccggggactccgccaacgagtgcctg
atctgtaactgcagcggaaggtcggaccagtgtgtgtttgacgcggagcagtaccggagc
accggcagtggggggcgctgtttgagctgcagagacctcacggacgggccccactgcgag
cgctgcagagagaaccactacagaacctctgctgaggagccctgcctgccctgcatctgc
aatattaacggttcggtgagcctgcagtgtgatgcggagggaaagtgcgcgtgccgaact
ggcgtgacaggggagaagtgtgacaaatgcgcggccggcttccattcgctggggcctgcc
ggctgcaggccatgtgagtgtgaccccagcgggagtgtgggcgactgttccccgtcagac
ggaggatgcgactgtaaggccaacgtggagggacaaagctgcggcaggtgcaagccggga
ttctacaacctccgaggagtcaacccggaaggttgccaagcgtgtttctgcttcggacat
tcgctggcctgctcctcctccagtcaccatgttgtggcaaacatcacctctgacttcctg
gaagatcaggacggctggctgggagagttctttggcgggcagagttaccccctgctgtgg
aaggaaggtgaagtctacctgctgcctctttctgaggatgacattggcttttacaaagct
cctgagaaattcctgggtcgccaagtctacagctatggccagctgctcaccattaccttc
acctcggagacggccgagcttctgcccaacaatgtcacgttgctcctccaaggctcggac
gccaccctaactgctgaactttcaccccagccgctgttcagccgcgaccctgacctcaca
ccacgacgttccttcgagatcaggctgcacgaacaagaggggtttgaaccggcactgtcg
gcctttgagttccagactttcctgtacaacctgacagatctgcgaatcagcaacgctgga
ggacgcaactacacgtcccagctcacgagcgtgaccttgatctcagctgccatctccgac
aagttatccggcccgcacgcccggtgggtagagtcctgcacctgccccccgggattcgcc
ggccagttttgcgagcagtgcgccccagggttcacccggcaggaccccggcggaggcccc
ctttcgccctgcgtgccgtgcaactgccatcaacatggaacctgccaccaggagacaggc
gtgtgcaactgctccgacttcacagcgggcaaggcctgtgagcgctgcctggagggttac
tatggaaacgccttgattggcatgcctggggattgtcagccttgcccctgcccggaccaa
agcagctgtgcccaaattgtgtcgacgggacaggtggtctgtaccaactgccctcgggga
cagacagggatgcgctgtcagctgtgtgaagacggttactatggtgaccccctcggacga
tccggggcggctcgtccgtgcgagaggtgcgactgcaacggcaacgtggacccgaacgcg
ctgggagtgtgcgaccacgcgagcgggcggtgcctgaaatgcctgggccacacggagggc
caccactgcgaacgctgccagcgggggttttacggcgacgccctggatcccacagccggg
aaaaaatgcaaaccatgcagctgtcatcctgccggaacctctggggatgtgagcgaatgc
caccctcagactggccgctgccgctgcctcgctcacgtgacgggacgcgtctgtgcttcc
tgcgaggtcggtttcttcaacctccagcctggtgtcggatgcgagagatgccagtgcaat
ccagtgggctcgtcgtccccggcgtgccaccccatcacgggacagtgtgtgtgccgcgct
ggggtggaggggacactctgccacacctgccggacgggtttctttgggttttcatcgcgg
ggttgcagagcctgtaactgtgacccaatgggctctgtttccatgcagtgtcacaacaac
ggcacctgccgctgtcgccgaggcttcgtgggctataagtgtgacaaatgtgagttgaac
tatttccacaacagggccacgcaccagtgtgaggaatgcccagtctgctacgggctggtc
cagaagcaggcggaaaagctgcggaatcggctccaggatttggagaatcttctggctcgc
ttcgactgccggagccgatccgggaggcacctgccctatcccaggcgtcccgcggccgag
cagcagagggaggagagtcttcccaacgctctggaggatttcctggcctttcaagaggca
cgggaggccttcataaagcaattttcctcgctggaagcttcgactggcagactcgtagcc
caactgcacggcgttacgtccgctttgaactgcagcctcgccgtgacggagggagggagc
acgaggagcgaggcgagcgggaaagctgagggcgtgtgtcagagcttcacagaggctgcg
ctcgtaatcagacgggctcagaagcagctacagcaggccacactggacctggataacatg
gtcattcctttcgagatgggctcagaacccaaccagtggaacatgatggtcaatgagtca
caagtcctgttgcaaagtcgcagggacacggcggagcacatcggagtcgtggccggcagc
gccgtgaacgcctccaagcaggccttgggtctcctgatgggtctgctgcaggacaactcc
acagaggagtacatcgggaacctcacggagcgcatcgcagagatgcaggagcagacggag
acgctcgcggagcagacggacgccgccgtagccgagcagctgaccctggaggccgaggcc
ggggcgctgcggcgcgccctcgccaacgtcacgtcctccttgcatcggttgctcccgaca
gaggccattccggaccagacgaaccgaaccggacacacgaacagcaccggggggcgggcc
gacgagctgctgcggcaaacggcggagctgcacctgcgcctccaggccagggacgagctc
ttggtgcagatggaagaggagaggaggcctctggagcaggctgccagggacaaggaggag
gtcctcgatgtggcgagcgagctgcaagctcgaacccacgaggcgaaggtcgtcgctctg
gcatcggtggtggaggggaaggacgtggagtcgtcggcgatgctgctgcgcaggcagctg
gaagacatggtgagcgagtggccccgtcggcgggcccagacacagagcgcgttgaagaag
gagaggcccctggagaacaagatcctggcctccatcgagaagagggtctcccacatccag
gagatgctggaacctgcggcggaaaactccagcgtctcgcggaaggtcgccaaggaagcg
gcagaaacggcggacgcggtggccaaagagtccaaagacgtcctgacccaggccaagcac
gccaggacggcgtccgcacacctcggctcccacatcgactctgctctacagcggctggtg
gagcaggaggcgctaactggtgctgcacactcccagatcacagagcccaaggtgtccctg
ggcgccgtaaaggaggacatggaagccgccaggctcgagctagcggcctactctgacacg
ctgactcagctaataaacaagatcgatgaaagcgtcccactggagcgcttcgaccgcatc
ctgaacgagacggcgcggcgcctccgcatgctccgcggcagcgtggagagcccccacctg
ggccggaaaatccagaagctgcacctggcggccgaggagcagcggagccagatgtccctc
atcgatcaggacctgcaggacatcagagaggagcgggacagtctccgggacatcgcctcc
aacctgccccgggcctgcccatccgccgaggcggccagaggctaa

DBGET integrated database retrieval system