KEGG   Takifugu rubripes (torafugu): 101061547Help
Entry
101061547         CDS       T02386                                 

Definition
son of sevenless homolog 2-like
Orthology
K03099  
son of sevenless
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101061547
   04012 ErbB signaling pathway
    101061547
   04630 Jak-STAT signaling pathway
    101061547
   04068 FoxO signaling pathway
    101061547
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101061547
  Cell communication
   04510 Focal adhesion
    101061547
   04540 Gap junction
    101061547
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101061547
   04912 GnRH signaling pathway
    101061547
  Development
   04320 Dorso-ventral axis formation
    101061547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1283 aa AA seqDB search
MQPQQIYDFSSDENSHKWRGLFVQALRKVQKQVHPGLMAKEDALQHIEELILQLLNMLCV
AQPRSVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGYK
VDYHVSLYIVAVLEYISADILKLAGNYVGNIRHYEISQQDIKVSMCADKVLMDMFDQEED
IGLMSQCTEEPSSSGELAYDDLVRLEIAEERQYLRELDLIIKVFRHHFLSNPKIFTPQDV
EVIFSNILDIHELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETMSQDI
LRKDFHEHFNNLMARPTAGLYFQSVAEGFKEAVQYVLPQLMMVPVYHCMHYFELLQQLQE
RSEDQDDRECLKQAITALLNLQCSVDRIYTKHQPRRKPGEPMYRLYSRQVRSKQLAIKRM
NEIQKSIDGWEGKDIGQCCSEFILEGPLIRAGAKHERHNFLFDGLMISCKANQSSRLPGS
GSGAEYRLKEKFVLRKVRIVDREDSVELRHAFELIGKDENCAVFCARTAEEKAAWMAALV
TLQYRSTLDRMLDTVLQHEEQEHPLRLPSPEVYRFAVQDSEENIVFEDKVQSKTGIPIIK
AGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLTLLIERIEIPEPEPTEEDRQA
LWNGDQPMAAELQRFRKEYVQPVQLRVLNVFRQWVEHHFYDFENDPELRSHLEEYITSKI
QLRGKSMRKWVESINKIIKRKLQTQANGVSHNITFESPPPPIEWHICRAGQVDAFDLMTL
HPIEIARQLTLLESELYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFEKCI
VETMNLEERVAVLSRVIEILQVFQELNNFNGVLEVVSAINSVPVYRLDHTFEAIPERKRK
LLEEAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLTRHSKELINFS
KRRKVAEITGEIQQYQNQPYCLKVEHEIRRFFENLNPMGNMGEKEFADYLFKMSLDIEPR
NCRQPPRFPRKTVYTLKSPGIRPVRTSTSGTLKGHPVPLEREPPHKITFRSIAETEPPET
PPSASVPTSPNTPTPPQSASSDLSSVFMEHDLGSLCGSDSLFGSAHLPTSKLQSVSCGSL
HQLGEEQLKPPPLPPRRKDAMSEAKLSSRSDSPPAIPPRLPPPFPRNQPRPVIYNGPPGD
GPLPSPPPPPPRDPLPDTPPPVPQRPPEIFINYPLNLQPSPVGRYHWEFSSSPSSPNTPP
STPSPRVPRRSCPLSASQNSLSV
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccagcagatatacgacttttcaagtgacgagaacagtcacaaatggagaggc
cttttcgtgcaagctttacgaaaggtgcagaagcaggtccacccgggcctcatggcgaag
gaggacgccctgcagcacatcgaggagctgatcctgcagctgctgaacatgctgtgcgtg
gcgcagccgcgctccgtgcaggacgtggaggaacgggtccagaaaaccttcccccaccct
atagataaatgggctattgcagacgcccagtccgccatcgagaaacgcaagaggcgaaac
cctttgcttctccccgtggacaagatacacccactgctgaaggaggttttgggctataaa
gtggactaccacgtctccctgtacatcgtggccgtgctcgagtacatatcggcagacata
ctgaagctggcgggcaactacgtggggaacattcgacactacgaaatcagccagcaggac
atcaaggtgtccatgtgcgccgacaaggtgctgatggacatgtttgaccaggaggaggac
atcggcctgatgtctcagtgcacggaggagccgtcctcctccggggagctggcgtacgac
gacctggtgaggctggagatcgcagaggagcggcagtacctgcgcgagctcgacctcatc
atcaaagtgttccgccaccacttcctctccaaccccaaaatcttcacgccgcaggacgtg
gaggtgatcttcagcaacatcctggacatccacgagctgacggtgaaactgctggggctg
atcgaagacgccgtggagatgacggccgacggcagcccccatccgctggtgggcagctgc
tttgaagacctagcggaggagcaggcctttgacccctacgagaccatgtctcaggatatc
ctccgcaaggatttccacgagcacttcaacaacctgatggcgcggccgaccgccggcctc
tacttccagtcagttgcagaaggcttcaaagaagccgtccagtatgttcttccccagctg
atgatggtcccggtataccattgtatgcactacttcgagctcctgcagcaacttcaggag
cgcagtgaggaccaagatgacagagagtgtctgaaacaggccatcacggcgctgctaaac
ctccagtgcagcgtggaccgcatctatactaaacaccagcctcgccgtaaacccggtgag
cccatgtaccgactgtacagcaggcaggtccgaagcaaacagctggccatcaagcggatg
aacgagatccagaagagcatcgacggctgggaggggaaggacatcggtcagtgctgcagc
gagttcatcctggagggcccgctgatacgggccggcgccaagcacgagaggcacaacttc
ctgtttgatggcctgatgatcagctgcaaggccaatcagagctccaggctcccgggttcg
ggcagcggggcggaataccgcctgaaggagaagtttgtgttgaggaaggtgcgcatcgtg
gatcgcgaggactccgtggagctgcggcacgctttcgaactgattggaaaggacgaaaac
tgcgcggttttctgcgcacggacagcagaggagaaggcggcgtggatggcggcgctggtc
actctgcagtaccgctccacgttggatcgcatgttggatacggtgctgcagcacgaggag
caagagcaccctctgaggctgccctccccggaggtgtaccgctttgccgtgcaggactcg
gaggagaacattgtgtttgaggacaaagtgcagagcaagacggggatccccatcatcaag
gccggcaccgtggtcaagctcatcgagaggctgacctaccacatgtatgctgatcctaac
ttcgtgcgcacgtttctcaccacatatcggtcgttctgcaaacctcaggagctcctcacc
ctgctgatagagaggatcgagatccctgagccggagccgactgaggaggaccgccaggct
ctctggaacggggatcagccgatggctgccgagctgcagaggttcaggaaggagtacgtg
cagccggtccagctcagggttctcaatgtgttccgccagtgggtggagcaccatttctac
gacttcgagaacgacccagagctgagaagtcacctggaggagtacatcaccagcaaaatc
caactgcgaggcaagtctatgaggaagtgggtggagtccatcaacaagatcatcaagagg
aagctgcagacgcaggccaacggcgtcagtcacaacatcaccttcgagagcccgcctccc
cccatcgagtggcatatatgcagggcggggcaggtggacgcctttgacctcatgaccctc
catcccatagagatcgctcgccagctgactctgctcgaatcggagctctacagagccgtg
aggccgtccgagctggtcggcagtgtctggaccaaagaggacaaagagaagaactcgcct
aacttgctccgcatgatccgccacaccaccaacctcacgctgtggtttgagaagtgtatc
gtggagaccatgaatctagaggagcgggtggccgtgctgtcgcgggtcatcgagatcctg
caggtgttccaggagctcaacaacttcaacggcgtgctggaggtggtcagcgccatcaac
tctgtcccagtgtacaggctggaccacacctttgaggcaatcccagaaaggaaaaggaaa
ctcctggaagaagctgtggagctgagccaggaccacttcaagaagtacctggctaaactc
aagtccatcaacccgccctgcgtccctttctttggtatctacctgaccaacatcctgaaa
acagaggagggcaacccagacttcctcacgcgccacagcaaggagctgatcaacttcagc
aagaggaggaaagtggctgaaatcaccggggagatccagcagtatcagaaccagccgtat
tgtctgaaggtggagcatgaaatcaggaggttcttcgagaacctgaacccgatgggcaac
atgggggagaaggagtttgccgactacttgttcaaaatgtctctggacatcgagccacgg
aactgcaggcagcctcccagatttcccaggaagaccgtgtacacgctgaagtccccgggg
atccgacccgtgcggacctctacctctggcacgctgaagggccacccggtccccctggag
cgggagcccccgcacaagatcaccttcaggagcatcgcggagaccgaaccgccggagacg
ccgccgtccgcctcggtgcccacctccccgaacacgccgacgcccccgcagtcggcctcg
tccgacctgagctcggtgttcatggagcacgacctgggcagcttgtgcggcagtgactcc
ttattcggttcggctcatcttccgacttccaagctccagtctgtgtcctgcggcagcctg
caccaactcggggaggagcagctgaagccccctccgctaccccccaggaggaaagatgcc
atgtctgaggctaaactgagctccaggtccgacagcccccccgccatcccgccccggctg
cctcctccttttcccaggaaccagccccgaccggtgatctacaacggcccccccggcgac
ggccccctgcccagccctcctccgccgcctccacgggaccctctgcccgacacgcctccc
ccggtgccccagcggcccccggagatcttcatcaactaccccctgaacctgcagccctcc
ccggtgggccgctaccactgggaattcagcagctccccgagctccccgaacactccaccc
agcacgccctcgccacgcgtcccccgccggagctgcccgctcagcgccagccagaacagc
ctctctgtttaa

DBGET integrated database retrieval system