KEGG   Takifugu rubripes (torafugu): 101061547Help
Entry
101061547         CDS       T02386                                 

Definition
son of sevenless homolog 2-like
Orthology
K03099  
son of sevenless
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tru04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:tru04012]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:tru04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tru04068]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:tru04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:tru04510]
Cellular Processes; Cell communication; Gap junction [PATH:tru04540]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:tru04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:tru04912]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:tru04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1283 aa AA seqDB search
MQPQQIYDFSSDENSHKWRGLFVQALRKVQKQVHPGLMAKEDALQHIEELILQLLNMLCV
AQPRSVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGYK
VDYHVSLYIVAVLEYISADILKLAGNYVGNIRHYEISQQDIKVSMCADKVLMDMFDQEED
IGLMSQCTEEPSSSGELAYDDLVRLEIAEERQYLRELDLIIKVFRHHFLSNPKIFTPQDV
EVIFSNILDIHELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETMSQDI
LRKDFHEHFNNLMARPTAGLYFQSVAEGFKEAVQYVLPQLMMVPVYHCMHYFELLQQLQE
RSEDQDDRECLKQAITALLNLQCSVDRIYTKHQPRRKPGEPMYRLYSRQVRSKQLAIKRM
NEIQKSIDGWEGKDIGQCCSEFILEGPLIRAGAKHERHNFLFDGLMISCKANQSSRLPGS
GSGAEYRLKEKFVLRKVRIVDREDSVELRHAFELIGKDENCAVFCARTAEEKAAWMAALV
TLQYRSTLDRMLDTVLQHEEQEHPLRLPSPEVYRFAVQDSEENIVFEDKVQSKTGIPIIK
AGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLTLLIERIEIPEPEPTEEDRQA
LWNGDQPMAAELQRFRKEYVQPVQLRVLNVFRQWVEHHFYDFENDPELRSHLEEYITSKI
QLRGKSMRKWVESINKIIKRKLQTQANGVSHNITFESPPPPIEWHICRAGQVDAFDLMTL
HPIEIARQLTLLESELYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFEKCI
VETMNLEERVAVLSRVIEILQVFQELNNFNGVLEVVSAINSVPVYRLDHTFEAIPERKRK
LLEEAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLTRHSKELINFS
KRRKVAEITGEIQQYQNQPYCLKVEHEIRRFFENLNPMGNMGEKEFADYLFKMSLDIEPR
NCRQPPRFPRKTVYTLKSPGIRPVRTSTSGTLKGHPVPLEREPPHKITFRSIAETEPPET
PPSASVPTSPNTPTPPQSASSDLSSVFMEHDLGSLCGSDSLFGSAHLPTSKLQSVSCGSL
HQLGEEQLKPPPLPPRRKDAMSEAKLSSRSDSPPAIPPRLPPPFPRNQPRPVIYNGPPGD
GPLPSPPPPPPRDPLPDTPPPVPQRPPEIFINYPLNLQPSPVGRYHWEFSSSPSSPNTPP
STPSPRVPRRSCPLSASQNSLSV
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccagcagatatacgacttttcaagtgacgagaacagtcacaaatggagaggc
cttttcgtgcaagctttacgaaaggtgcagaagcaggtccacccgggcctcatggcgaag
gaggacgccctgcagcacatcgaggagctgatcctgcagctgctgaacatgctgtgcgtg
gcgcagccgcgctccgtgcaggacgtggaggaacgggtccagaaaaccttcccccaccct
atagataaatgggctattgcagacgcccagtccgccatcgagaaacgcaagaggcgaaac
cctttgcttctccccgtggacaagatacacccactgctgaaggaggttttgggctataaa
gtggactaccacgtctccctgtacatcgtggccgtgctcgagtacatatcggcagacata
ctgaagctggcgggcaactacgtggggaacattcgacactacgaaatcagccagcaggac
atcaaggtgtccatgtgcgccgacaaggtgctgatggacatgtttgaccaggaggaggac
atcggcctgatgtctcagtgcacggaggagccgtcctcctccggggagctggcgtacgac
gacctggtgaggctggagatcgcagaggagcggcagtacctgcgcgagctcgacctcatc
atcaaagtgttccgccaccacttcctctccaaccccaaaatcttcacgccgcaggacgtg
gaggtgatcttcagcaacatcctggacatccacgagctgacggtgaaactgctggggctg
atcgaagacgccgtggagatgacggccgacggcagcccccatccgctggtgggcagctgc
tttgaagacctagcggaggagcaggcctttgacccctacgagaccatgtctcaggatatc
ctccgcaaggatttccacgagcacttcaacaacctgatggcgcggccgaccgccggcctc
tacttccagtcagttgcagaaggcttcaaagaagccgtccagtatgttcttccccagctg
atgatggtcccggtataccattgtatgcactacttcgagctcctgcagcaacttcaggag
cgcagtgaggaccaagatgacagagagtgtctgaaacaggccatcacggcgctgctaaac
ctccagtgcagcgtggaccgcatctatactaaacaccagcctcgccgtaaacccggtgag
cccatgtaccgactgtacagcaggcaggtccgaagcaaacagctggccatcaagcggatg
aacgagatccagaagagcatcgacggctgggaggggaaggacatcggtcagtgctgcagc
gagttcatcctggagggcccgctgatacgggccggcgccaagcacgagaggcacaacttc
ctgtttgatggcctgatgatcagctgcaaggccaatcagagctccaggctcccgggttcg
ggcagcggggcggaataccgcctgaaggagaagtttgtgttgaggaaggtgcgcatcgtg
gatcgcgaggactccgtggagctgcggcacgctttcgaactgattggaaaggacgaaaac
tgcgcggttttctgcgcacggacagcagaggagaaggcggcgtggatggcggcgctggtc
actctgcagtaccgctccacgttggatcgcatgttggatacggtgctgcagcacgaggag
caagagcaccctctgaggctgccctccccggaggtgtaccgctttgccgtgcaggactcg
gaggagaacattgtgtttgaggacaaagtgcagagcaagacggggatccccatcatcaag
gccggcaccgtggtcaagctcatcgagaggctgacctaccacatgtatgctgatcctaac
ttcgtgcgcacgtttctcaccacatatcggtcgttctgcaaacctcaggagctcctcacc
ctgctgatagagaggatcgagatccctgagccggagccgactgaggaggaccgccaggct
ctctggaacggggatcagccgatggctgccgagctgcagaggttcaggaaggagtacgtg
cagccggtccagctcagggttctcaatgtgttccgccagtgggtggagcaccatttctac
gacttcgagaacgacccagagctgagaagtcacctggaggagtacatcaccagcaaaatc
caactgcgaggcaagtctatgaggaagtgggtggagtccatcaacaagatcatcaagagg
aagctgcagacgcaggccaacggcgtcagtcacaacatcaccttcgagagcccgcctccc
cccatcgagtggcatatatgcagggcggggcaggtggacgcctttgacctcatgaccctc
catcccatagagatcgctcgccagctgactctgctcgaatcggagctctacagagccgtg
aggccgtccgagctggtcggcagtgtctggaccaaagaggacaaagagaagaactcgcct
aacttgctccgcatgatccgccacaccaccaacctcacgctgtggtttgagaagtgtatc
gtggagaccatgaatctagaggagcgggtggccgtgctgtcgcgggtcatcgagatcctg
caggtgttccaggagctcaacaacttcaacggcgtgctggaggtggtcagcgccatcaac
tctgtcccagtgtacaggctggaccacacctttgaggcaatcccagaaaggaaaaggaaa
ctcctggaagaagctgtggagctgagccaggaccacttcaagaagtacctggctaaactc
aagtccatcaacccgccctgcgtccctttctttggtatctacctgaccaacatcctgaaa
acagaggagggcaacccagacttcctcacgcgccacagcaaggagctgatcaacttcagc
aagaggaggaaagtggctgaaatcaccggggagatccagcagtatcagaaccagccgtat
tgtctgaaggtggagcatgaaatcaggaggttcttcgagaacctgaacccgatgggcaac
atgggggagaaggagtttgccgactacttgttcaaaatgtctctggacatcgagccacgg
aactgcaggcagcctcccagatttcccaggaagaccgtgtacacgctgaagtccccgggg
atccgacccgtgcggacctctacctctggcacgctgaagggccacccggtccccctggag
cgggagcccccgcacaagatcaccttcaggagcatcgcggagaccgaaccgccggagacg
ccgccgtccgcctcggtgcccacctccccgaacacgccgacgcccccgcagtcggcctcg
tccgacctgagctcggtgttcatggagcacgacctgggcagcttgtgcggcagtgactcc
ttattcggttcggctcatcttccgacttccaagctccagtctgtgtcctgcggcagcctg
caccaactcggggaggagcagctgaagccccctccgctaccccccaggaggaaagatgcc
atgtctgaggctaaactgagctccaggtccgacagcccccccgccatcccgccccggctg
cctcctccttttcccaggaaccagccccgaccggtgatctacaacggcccccccggcgac
ggccccctgcccagccctcctccgccgcctccacgggaccctctgcccgacacgcctccc
ccggtgccccagcggcccccggagatcttcatcaactaccccctgaacctgcagccctcc
ccggtgggccgctaccactgggaattcagcagctccccgagctccccgaacactccaccc
agcacgccctcgccacgcgtcccccgccggagctgcccgctcagcgccagccagaacagc
ctctctgtttaa

DBGET integrated database retrieval system