KEGG   Takifugu rubripes (torafugu): 101061739Help
Entry
101061739         CDS       T02386                                 

Definition
(RefSeq) acetyl-CoA carboxylase-like
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101061739
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    101061739
   00640 Propanoate metabolism
    101061739
  Lipid metabolism
   00061 Fatty acid biosynthesis
    101061739
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    101061739
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101061739
Enzymes [BR:tru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     101061739
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     101061739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 2417 aa AA seqDB search
MFTACSCPAMAQQNGAAGKRPAAAAALHSRFLVGSVSEENSEDEIQGKADLQLEEKENRS
VSPSSCSSDSAYETGFDQVDGTAHNLRPSMSGLHLVKQGRDRRRIDLQRDFTVASPAEFV
TRFGGNKIIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYI
KMADHYVPVPGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAF
MGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGAGLTVEWSEANQKKRIINVPTDVYELG
CIQGVEDGLKAAEEIGYPVMVKASEGGGGKGIRKVNCAEDFPNLFRQVQAEVPGSPIFVM
QLAKHARHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATTDIFEDMENCAV
KLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIP
LQRIKDIRMLYGVQPWGDSPIDFEGLATAPSPRGHVIAARXTSENPDEGFKPSSGTVQEL
XFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRT
TVEYLIKLLETESFQHNSIDTGWLDRLISEKMQAERPDTMLGIVSGALHVADVSFRNSVS
NFLHSLERGQVLPAHTLVNTVDVELIYEGTKYVLSVTRQSPNSYVVIMNNSSAEVDVHRL
SDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSLLRSPSAGKLIQFTVED
GGHVFSGQCYAEIEVMKMVMTLTAAESGCIHYVKRAGAALEPGCVIAKLQLDDPSRVQQA
DLHTGALPIIQAVALRGEKLHRVFHSTLDHLVHIMNGYCLPEPFFFTKLKEWVERLMKTM
RDPSLPLLELQDIMTSVSGRIPPAVEKAIKKEMAQYASNITSVLCQFPSQQIANILDSHA
ATLNKKSEREVFFMNTQSIVQLVQKYRSGIRGHMKAVVMDLLRQYLKVEIQFQHGHYDKC
VFTLREENKGDMANVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELMAILTELTQL
SKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETS
IFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFMLPTSHP
NRGNIPTLNRRMSAPILDSLKAMDTKLQETKSQDGNAHSKSKDDNPEKKKASDLESVDRM
SFSSNLNHYGMVHAASVSDVLLDTSFTPPCQRMGAMVAFRSFQEFTRNITDVLSCFTDSP
PPSPTFPEGGNPVLYGEEDNKSILDEPIHILNVAIKTDSDIGDDSLAASFREFTQSKKSL
LFEHGIRRLTFLVAQKDFRKQINCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALA
FQLELNRMRNFALTAIPCANHKMHLYLGAARVEVGTEVTDYRFFVRAIIRHSDLVTKEAS
FEYLHNEAERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMR
YGSRLWKLRVLQAELKINIRLTPTGKQIPIRLFLTNESGYYLDISLYKEVTDSRTGQVGP
KDQQIMFQAYGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYVYDFPEMFRQALKK
LWHSTQTYANLPKCPAPSELLTFTELVLDAQGQLVQMNRLPGGNEIGMVAWRMTLRTPEY
PAGREIIVISNDITHKIGSFGPQEDILFLRASEMARDSGIPRIYIAANSGARIGLAEEIR
HMFHVAWQDPADPYKGFKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKDEG
LGVENLKGSGMIAGESSLAYEEIITMNLVTCRAIGIGAYLVRLGQRTIQVDNSHIILTGA
GALNKVLGREVYTSNNQLGGIQIMHNNGVTHNTVCDDFEGVFNLLQWLSYMPKSKNSPVP
ILDGKDPIDRLVEFVPTKAPYDPRWMLAGRPNQTPKGSWQSGFFDYGSFMEIMQPWAQSV
VVGRARLGGIPTGVVAVETRSVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIK
DLNREGLPLIVFANWRGFSGGMKDMYDQVLKFGAYIVDGLREYKQPVLVYIPPQAELRGG
SWVVIDPTINPRHMEMYADKDSRGGVLEPEGTVEIKFRRKDLVKTMRRVDPIYTSLAERL
GTPELSPPDRKELETKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVITDILEWPTS
RQFFYWRLRRLLLEETVKRKIQEANSELTDGQVQAMLRRWFVEAEGAVKAYLWENNNEEV
VAWLEKQLAEEEGARSVIDENIKYIRRDHILKQIRSLVQANPEVAMDSIVHMTQHISPTQ
RTEVVRILSTMETSASS
NT seq 7254 nt NT seq  +upstreamnt  +downstreamnt
atgttcacggcctgttcgtgtccagccatggcacaacagaatggtgctgcaggtaagagg
cctgctgctgctgcagcgctgcactcgcgcttcttggtgggatcggtgtcggaggagaac
tcggaggatgagatccaagggaaggctgacctgcagctggaggaaaaggagaatcggtca
gtgtcgccatcctcctgcagttcagacagtgcctatgaaactggatttgatcaagtggat
ggcactgcacacaatctaaggccgagcatgtccgggctgcacttggtgaagcaaggcagg
gatcgccgtcgcatcgatctgcagagggacttcaccgtagcttcccctgcggagtttgtc
acccgctttggtggcaacaaaatcatcgagaaggtgcttattgccaacaatggtattgca
gcagtcaagtgcatgcgctccatccgccgctggtcctacgagatgtttcgaaacgaaaga
gccatccgatttgttgtcatggttactccagaggacctgaaggccaacgcagagtacatc
aagatggcagatcattatgtaccagtgccaggagggactaacaacaataactatgctaat
gtggaactcattctagatattgctaaacgcatacctgtccaggcagtgtgggctggctgg
ggtcatgcctcagagaacccaaagcttccagagctacttcacaaaaatggaattgccttc
atgggacccccaagtcaagctatgtgggctctaggtgataagattgcctcatccatcgtt
gctcagactgctggcattcccaccctgccgtggagtggtgcagggctgacggtagaatgg
tcagaagctaaccagaagaagagaatcattaacgttcccactgatgtgtatgagctgggc
tgcatccagggtgtagaggatggcctcaaagctgctgaagaaattggctaccctgtaatg
gtgaaagcttcagaaggaggtggggggaaaggcatccgtaaagtcaactgtgcggaggat
ttccctaacctcttcagacaggtccaggcagaagttccaggctcacctatttttgtcatg
caactagccaaacatgcccgacacctggaggtccagattctggctgatcagtatggcaat
gccatttcactgtttggccgggactgttctgtgcagcgacgacatcagaagattatagaa
gaggcacctgctaccatcgccacgactgacatttttgaggatatggaaaattgtgcagtg
aagctggctaagatggtggggtacgtcagtgcgggcacagttgagtacctctacagccag
gatggcagcttctacttcctggaactcaacccccgactacaggtggaacacccctgcact
gagatggtggctgatgtcaacttaccggctgctcagctacagattgctatgggtattccc
cttcaaagaatcaaggatatcaggatgctttacggtgtccaaccttggggagactcccca
attgactttgagggtcttgcaacagcgccttccccacggggccacgtaatcgcagcaaga
ntcacaagtgaaaatcctgacgagggtttcaaaccaagttcaggaacagtacaggagcta
naattccgcagcaataagaacgtctggggctacttcagcgtggcagcagctggaggtttg
cacgagtttgccgactcacagttcggacactgtttctcgtggggagagaatcgggaagaa
gccatttccaatatggtggtggctctgaaagagttgtctatccgaggggacttcaggacc
acagtagaatacctcataaagctcctggagactgaaagctttcagcacaacagcattgac
acaggctggcttgacaggttgatctcagagaaaatgcaggcggagcgtcctgacaccatg
ctgggcattgtgagcggggctcttcacgtggcggatgtcagttttagaaacagcgtgtcc
aactttctgcattctctggaaaggggtcaggtgctgccagcacatactctggttaacacg
gtggatgtggagctcatctatgaaggcacgaagtacgtactgtcagtgacacgccagagt
cccaactcctacgtggtcatcatgaacaactcctcagctgaggtggatgttcatcgacta
agtgatggaggcctcttgctgtcttatgatggaagcagctacactacctatatgaaggaa
gaggtggacaggtatcggatcacaatcgggaacaaaacctgtgtttttgaaaaagagaat
gacccttcgctgctaagatctccttcggcaggaaaactgatccagttcacagttgaggac
ggtggacatgtgttctcagggcagtgctatgctgaaatagaggtgatgaagatggtaatg
acacttacagctgcagagtctggttgtattcactatgtgaagagggctggagcagcactg
gagcctggctgtgtcattgccaagctgcaactagatgaccccagtagggtgcaacaggcg
gacctgcatacaggtgctctgcctataatccaggccgttgctctgagaggagagaaacta
cacagagttttccacagcacactggatcatcttgttcatattatgaatggttactgtctt
cctgagcctttcttcttcaccaagttaaaagaatgggtggaaaggttaatgaaaaccatg
cgggatccctcgttgccgctgttggagcttcaagacataatgacaagtgtgtctgggcgc
atccctcctgccgtggagaaggccatcaaaaaggagatggctcagtatgccagcaacatc
acatccgttctctgccagtttcccagccagcagattgcaaacatccttgacagccatgct
gctactcttaacaagaagtcagagagagaagtcttttttatgaacacacaaagcattgtt
cagctggtgcaaaagtatcgcagtggcattcgagggcacatgaaggcagtggtgatggac
ctgctcagacagtatttgaaagtagagattcagtttcagcatggacattatgacaagtgt
gttttcacgctacgtgaagaaaacaaaggcgacatggccaatgtgctcaattatattttt
tcccacgctcaagtcacaaagaaaaacctcttggtcactatgctgattgaccaactatgt
ggcagggatcctacgctgacagatgaactgatggccatcttgactgaacttacccaattg
agcaaaacaaccaatgccaaggtggcactgcgcgccagacaggtgttgattgcgtcccac
ctcccttcctatgagctacggcataaccaggtggaatccatcttcctctctgctattgac
atgtatggacaccagttctgtatagagaacctgcagaaactgatcctatcagaaacatcc
atctttgatgtcctcccaaacttcttctaccacagtaatcaggtagtcaggatggccgcg
cttgaggtgtacgttcgcagagcctacatcgcatatgagttgaacagcgtccagcatcgt
cagctgaaggacaacacatgtatagtggagttccagttcatgctgcccacatcccacccc
aacagagggaacatccccactctaaacaggagaatgtccgccccaatcctggacagtcta
aaagccatggacactaaattgcaggaaacaaaatcccaggatggtaatgcacatagtaaa
tctaaggatgataatcctgagaagaaaaaggcctcagatttggagtcagtggacaggatg
tcattctcatccaacctgaaccactacggcatggtgcatgcagccagcgtcagcgacgtc
ctgctcgacacatcgttcacgccgccctgtcagcgtatgggagccatggttgctttccgc
tcctttcaggagttcaccaggaacataacagatgtgttgagctgcttcactgactctcct
ccaccaagtcccaccttccccgaaggaggaaatcccgttctttatggcgaagaggacaac
aagagcatcctggatgagcccatccatatcttgaacgtagccataaagaccgacagtgac
attggtgatgacagccttgcagccagcttcagagaattcactcagtctaagaaatctctg
ctgtttgaacatggaatccgtaggctgacgttccttgtggctcagaaggatttcaggaag
caaatcaactgtgaggtggaccaaaggtttcatagggaattccccaaattcttcacattc
cgtgctagagataagtttgaggaagacaggatctaccgtcatttggaaccagcactagct
ttccagttagagctcaaccgcatgcgtaattttgccctgactgccatcccatgtgccaac
cacaagatgcacctgtacttgggtgcagcgcgcgtggaagtgggcacggaggttacggac
taccgtttcttcgtgcgagccatcatccgccattcagatctggttacaaaggaggcatcg
tttgaatatcttcacaatgaagcagagcgtctgctgttggaagccatggatgaactggaa
gtggccttcaacaacacatctgtacggacagattgcaaccatatcttcctcaattttgtt
cccacagtcatcatggacccatcaaagattgaggaatctgtgcgttctatggtgatgcgt
tatggcagccgtctgtggaagctgcgggtgctgcaggctgagctgaaaatcaacatccgc
ttgactccaactggcaagcaaatccccatccgcctctttctgaccaatgaatcaggctac
tacctggacatcagcttgtacaaggaggtcactgattcccgaacgggacaggtggggccc
aaagatcaacagatcatgttccaagcatacggagacaagcaaggcccattgcacggcatg
ctcatcaacacgccgtatgttaccaaggatttgctgcagtcgaagcgtttccaggcgcag
tccctgggcaccacttatgtctacgactttccagaaatgttcagacaggctctcaaaaaa
ctgtggcattccacccagacttatgccaacttgccaaaatgtcctgccccctctgagctg
cttaccttcacagagctggttctcgatgctcagggtcaactggtgcagatgaaccgactg
ccagggggcaatgagattggaatggttgcatggcgaatgactctgcgcacaccagaatat
ccagcgggacgtgagatcattgtcattagtaacgacatcacacacaagataggatccttt
ggcccgcaggaggacatactgttcctacgagcctcagagatggcacgtgacagtggcatc
cctcgaatctacattgcggccaacagcggtgcccgtatcggactggccgaagagatccga
cacatgttccacgtggcatggcaagacccagctgacccctataagggttttaaatatctc
tacctcacacctcaagattacaagaaagtatctgctctgaactctgtgcattgcgagcat
gtggaggacgagggtgaatccaggtacaagatcactgacatcattggaaaggatgaaggg
ctgggggtggaaaatctgaaagggtctggaatgattgctggagagtcatctttggcttat
gaggagattatcaccatgaacttggtcacttgcagagccatagggattggggcctatctg
gtgaggctgggacagagaactattcaagtggacaattctcacattatcctcactggtgct
ggagctctcaacaaggtgctgggaagagaagtgtacacatcaaacaaccaacttggcgga
atccagatcatgcacaacaatggtgtgacccataacacagtgtgtgatgactttgaagga
gtcttcaatcttctgcagtggctatcttacatgcccaagtctaaaaacagcccagtgccc
atccttgatggcaaagatcccatcgatcgactggtggagtttgtacccacaaaggctccc
tatgaccctcgctggatgctagcagggcgcccaaatcagactccaaaaggttcctggcaa
agtggtttcttcgactatggctccttcatggagatcatgcaaccttgggctcagagtgtg
gtagtgggcagagccagactaggaggcatacccacaggggtagttgctgtggaaaccagg
tcagtggaactgtcaatcccagcagacccagccaacttggactcagaggctaagatcatc
cagcaagcaggacaggtgtggttcccggattctgcatttaaaacagcccaggccattaag
gatctgaacagagagggcttgcctctcatcgtgttcgccaactggagaggcttttctgga
ggaatgaaagatatgtacgaccaggtgttgaagtttggagcctacattgtggatggactg
agggagtacaagcagccggtgctggtttatatccctccacaggcagagttgagaggaggc
tcttgggtggtcattgatcccaccatcaacccccgtcacatggagatgtacgccgacaag
gacagcagaggtggagtgctggagcctgaggggacggttgagatcaagtttaggcgcaaa
gatctggtgaagactatgagaagagtagatccaatctacacgagtttggccgaaagactg
gggaccccggagctgagtccaccagaccgcaaagagttggaaaccaagctgaaggagcgt
gaagagtttctcctgcccatctaccaccaggtcgctgtgcagtttgcagacctccacgac
acaccgggtcgcatgcaagagaagggcgtcattacggatatccttgaatggccaacatct
cgtcagttcttctactggcgtctgaggcgactgctgttagaggagacggtgaagaggaag
atccaggaggctaacagcgagctgacggacggtcaggtccaggcaatgctgcgccgctgg
tttgtggaggctgaaggagcagttaaggcctatctgtgggagaacaacaacgaggaggtg
gtggcgtggctggagaagcagctcgctgaagaagagggcgcgcgatccgttatcgacgag
aacatcaaatacatccgccgagatcacatcctcaagcagatacgcagccttgttcaagca
aatccagaagtggccatggattccatagtgcacatgacccagcacatctcacctacacag
agaacggaggtggtgcgtatcctgtccactatggagacgtcagcatcctcctaa

DBGET integrated database retrieval system