KEGG   Takifugu rubripes (torafugu): 101061755Help
Entry
101061755         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 37-like
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 797 aa AA seqDB search
MAQTGPIVSSSGTVQIRFSSIDLGTTKWREGTFEILEKDNKISLCLRFNCGTLKIFQLNQ
NLKTFSQNLSRIQLNLKDSSVIVLDKVPQMLVQRTYEYLKKLKQEKEVRKSFNGSGNFGV
LGNCSLKNESRPLAETQKPPRWGATECLVDTVQKKPLVSPSRPAAIPSFTGLSENRNEKR
KRPFQYISDLVEEPPKDQGSSRTSSSPRTTTVTGSNSLPHHSTPFKRIHRPIDYGGWRKP
RLSNPAQPQPPLQGFSNLGNTCYMNAILQSLFSVPSFSKDMLSQSVPWSKVSINGLIRCF
VHLLAKKDVGSSETKKDLLRKVKNAISSTVERFSGNMQNDAHEFLCQCLDQLKEEVAKVN
KSLTNEAMVTSPVRTGGKGGQDSVSSTARSGGLKEVGPALIYTCPVVNNMEFEVQHTITC
KSCGEVVTKHERFNDLSIDLPRRKKKLTLCSIQDSLDLFFRMEEIEYSCEKCSGKAATVS
HKFSKLPRVLILHLKRYNYDPQLSLNNKLGQRVVIPRYLTLLSHCTQVTQPPVSISWVTQ
TSIPFEEEPWSSPDTGFEDTEAQDLAYITDLLETRQPADMDEFLDMTMDEDKENQTPKGL
QWERDLDSQCNRNQEREEQELQQALTQSLMECAAQEMREEDDLRRATELSLQEFNRSLPE
MLCSDDDSGNQDMMDTDWTEAEDESPKRNAESGDLANSFRLISVVSHIGGSSSSGHYISD
VYDTKKQSWLTYNDLEVSETQEAVVQRDRDRSGYIFFYMHKDVLEQLSEMEKSGGIATTG
RKQCCSTPVNRFTFKQD
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaactggacccatagtctccagtagtggcactgtccagatccgcttcagtagc
atagacctgggaaccaccaaatggcgagagggaacatttgaaatcctggaaaaggataac
aagatctctctctgtttaagattcaactgtggaactttgaagatttttcagctgaatcag
aatctgaagacattcagccaaaatttgagccgcatacagctaaacttgaaggacagtagc
gtcattgtcctggataaagtgccccagatgttggtacagcggacctatgaatacctgaaa
aaattaaagcaggagaaagaagttcgaaaatcatttaacggaagtggaaactttggtgtg
cttgggaactgctctctgaaaaatgaatccaggccccttgctgagacacagaaaccaccg
aggtggggagctacagagtgcctggtggacacggtgcaaaagaagcctttggttagtcca
agtagacccgccgccattccgtccttcactggactctctgagaatagaaacgagaaaaga
aaaaggccctttcaatacataagtgacctagtggaggaacctcctaaggaccagggctcc
tccaggacatccagttctccacggactaccacagtgactggctccaactcgcttccccat
cattccactccctttaagagaattcacagacccattgactatggtggctggagaaagccg
agactttccaacccggcacaaccgcagcctccactacaaggattctccaacctggggaac
acttgttacatgaatgctatactgcagtcactcttcagtgtcccttccttctccaaagac
atgcttagtcagagcgttccttggagcaaggtatcaatcaatggacttatcaggtgtttt
gttcatctcctggccaagaaggatgtaggaagctctgagactaaaaaagaccttctgaga
aaagtgaagaatgccatctcctctacagttgagcgtttctctggaaacatgcaaaatgat
gcgcatgagttcctttgccagtgtttggaccaattaaaagaggaggtggcaaaggtcaat
aaaagtttgacaaatgaggctatggtgacctcacctgtccgcacgggtggtaagggtggc
caggactctgtctcgtcaacagccaggtcggggggtcttaaagaggtgggccccgccctc
atctacacctgccctgtggtaaacaacatggagtttgaggtgcagcataccatcacctgc
aaaagctgcggtgaagtggtgaccaagcacgagcggttcaatgacttgtccattgatcta
ccacgcagaaagaaaaaactcactctttgttctattcaagattctctggatctttttttt
aggatggaggagatcgagtactcttgtgagaagtgcagtggaaaagcagcaactgtctct
cataagttcagcaagttgcccagagtgctcattttacacttaaaacgttacaactacgac
cctcagctgtctctgaacaacaagcttggtcagcgggtagtgattcctcggtacctgact
ctgctgtcccactgcacccaggtcacacaacctcctgtcagtatcagctgggtcactcaa
acctccataccttttgaggaagaaccatggagcagccctgatacaggatttgaggacaca
gaggctcaagacttggcctacattacagatctacttgagaccagacagccagctgacatg
gatgagttcttagacatgaccatggacgaggacaaggagaaccaaacccccaagggtctg
cagtgggaaagagatctggactcacagtgtaatcgtaatcaggagagggaagagcaggaa
cttcagcaggccttgacccagagtctgatggagtgtgcagcccaagagatgagggaggag
gatgatctgaggagggctacagaactcagtctgcaagagtttaacaggtctctgcctgag
atgttgtgctcagatgatgactctggaaatcaggacatgatggatactgactggaccgag
gcagaggatgagagcccaaagagaaatgctgagagtggagacctggccaactctttcaga
ctcatcagtgtcgtcagtcacattggaggcagctcttcctctggtcattacatcagtgat
gtgtatgacacgaagaagcagtcgtggctgacgtacaatgacctggaggtatcagagacg
caggaagctgttgttcagcgggaccgtgatcgcagcggttacatattcttctacatgcac
aaggatgtgttggaacaactgtctgaaatggagaaatcaggaggcatcgccaccacagga
aggaagcaatgctgctccacccctgtgaatcgattcacatttaaacaggactga

DBGET integrated database retrieval system