KEGG   Takifugu rubripes (torafugu): 101061885Help
Entry
101061885         CDS       T02386                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     101061885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 269 aa AA seqDB search
MSADVSASPPSLAELVSFIGRTVGAGAALTAAVYLLRKVCLIMAWKSGGTSHAELVNNLR
KNGIIKSDKVYEVMLATDRAHFSRCNPYMDSPQSIGFQATISAPHMHAYALELLHDQLYE
GAKALDVGSGSGILSVCFARMVGAKGKVIGIDHIKELVDDSISNVKKDDPSLITSGRVKL
IVGDGRMGHGEEAPYDAIHVGAAAPTVPQALLDQLKPGGRLILPVGPAGGNQMLEQYDKL
EDGSTKMKPLMGVIYVPLTDREKQWSRWK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgacgtatccgcctcaccgccgtctctggcggagcttgtcagcttcatcggc
aggaccgttggcgcaggcgcggcattgacagctgctgtctacttactccgcaaagtctgt
ctaataatggcctggaaatctggaggaaccagccacgcagagcttgtcaacaacctccgc
aaaaatggcatcattaagtccgacaaggtctacgaagtcatgctggccaccgaccgagcc
catttctcccggtgtaacccgtacatggactcgccccagtccataggctttcaggccacc
atcagtgctccacacatgcatgcctacgctctcgagctcctgcacgaccagctgtacgag
ggggccaaggccctggacgtggggtccggcagtgggattttgtccgtttgcttcgcacga
atggtgggagctaaagggaaggtgatagggatcgaccacatcaaggagctggtggatgat
tccattagcaatgtgaagaaagacgaccccagtttgataacatctggcagggtcaagctg
atcgtgggggatggacggatgggccacggcgaggaagcaccttacgacgccatccacgtt
ggagcggcggcccccaccgtcccccaggctctcctggaccagctgaagcccggcggcagg
ctcatcctgcctgtgggccccgccggggggaaccagatgctggagcagtacgacaagctg
gaggacggcagcaccaaaatgaagcccttgatgggggtgatttatgtgcctttaacagac
agagaaaagcagtggtccaggtggaagtga

DBGET integrated database retrieval system