KEGG   Takifugu rubripes (torafugu): 101061937Help
Entry
101061937         CDS       T02386                                 

Gene name
ugp2
Definition
(RefSeq) UDP-glucose pyrophosphorylase 2
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00040  Pentose and glucuronate interconversions
tru00052  Galactose metabolism
tru00500  Starch and sucrose metabolism
tru00520  Amino sugar and nucleotide sugar metabolism
tru01100  Metabolic pathways
Module
tru_M00361  Nucleotide sugar biosynthesis, eukaryotes
tru_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101061937 (ugp2)
   00052 Galactose metabolism
    101061937 (ugp2)
   00500 Starch and sucrose metabolism
    101061937 (ugp2)
   00520 Amino sugar and nucleotide sugar metabolism
    101061937 (ugp2)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     101061937 (ugp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 101061937
NCBI-ProteinID: XP_003963857
UniProt: H2TVH2
Position
4
AA seq 508 aa AA seqDB search
MEFCLGDLCKGDAERGMAQFEEMMRQQLESSMHSELEKLLDTTTGPEKEVSRKDFEGFSN
LFHRFLQVKGPSVEWIKIRRPPEDSIQPYDKIAARGLPNNVAESLNKLVVVKLNGGLGTS
MGCKGPKSLISVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYKH
HRVKIHTFNQSRYPRINKESLLPVATDLSMKGPNAEAWYPPGHGDIYASFYNSGLLDQLI
AQGREYIFVSNIDNLGATVDLHILRQLVSQPNGKRCEFIMEVTDKTRADVKGGTLIQYDG
KLRLLEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAIKRLQEQSMMDMEIIVNPKTLD
GGLNIIQLETAVGAAIKSFDNALGINVPRSRFLPVKTTSDLLLVMSNLYSLDAGSLTMSP
KREFPTTPHVKLGCSFTKVQEYLTRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPAGSMLENKIVSGNLRIMDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggaattttgtctaggagatctgtgtaaaggagacgcagaaagagggatggctcagttc
gaggaaatgatgcggcagcagctggagagctcgatgcacagtgagctagagaagctgctg
gacaccaccactgggcctgaaaaagaggtgtccaggaaagattttgagggcttcagcaat
ctcttccacagatttctgcaggtgaaggggccttcggtggagtggataaagatacgacga
cctccggaggactcgattcaaccctacgataaaatcgccgcccgaggccttccgaacaat
gtcgccgagagcctcaacaagctggtggtggtgaagctgaatggaggcctgggcaccagt
atgggctgcaagggccccaagagcctgatcagcgtgcgcaatgagaacacgtttctggac
ctgacagtgcagcagattgagcatttgaacaagacctacaacaccgacgtgccgctggtg
ctcatgaactcattcaacacggatgaagatacgaagaagatcctccaaaagtacaagcac
caccgtgtcaagatacacaccttcaaccagagcaggtacccccgcatcaacaaagaatcc
ctcctcccggtggccacagacctgagcatgaaggggccgaacgcggaggcctggtaccct
cccgggcacggtgacatctacgccagcttctacaactcgggcctgctggaccagctgatc
gcgcagggccgcgagtacatcttcgtgtccaacatcgacaacctgggggccacggtcgac
ctccacatcctgcgccagctggtcagccagcccaacgggaagcggtgcgagttcatcatg
gaggtgacggataagacgcgcgccgatgtgaagggcggcacgctgatccagtatgatggg
aagctgcgtctgctggagatcgcccaggttccaaaggcccacgtggatgagttcaagtcg
gtctccaagttcaagatcttcaacaccaacaacttgtggatctctttggctgccatcaag
aggctgcaggagcagagtatgatggatatggagatcatcgtgaaccccaagactcttgac
ggcgggctgaacatcatccagttggaaacggcggtcggcgcggccattaaatccttcgac
aacgccctcggcatcaacgtgccgcgcagccgcttcctgcccgtgaagaccacgtcagac
ctgctgctggtcatgtccaacctgtacagcctggacgccggctcgctcaccatgagcccc
aaaagggagttcccgacaacgccgcacgtcaaactgggatgctccttcaccaaggttcag
gagtacctgacgcgcttcgagagcatcccagacatgctggagctcgaccacctcaccgtt
tctggagacgtgacctttggaaaaaatgtttcgctcaaaggcaccgtcatcatcatcgct
aaccacggagaccggatcgacataccagccggctccatgctggagaacaaaatagtttct
ggcaacctccgcatcatggaccactga

DBGET integrated database retrieval system