KEGG   Takifugu rubripes (torafugu): 101062000Help
Entry
101062000         CDS       T02386                                 

Gene name
hibch
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101062000 (hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101062000 (hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101062000 (hibch)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     101062000 (hibch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1
AA seq 382 aa AA seqDB search
MSFIVLTPKYRLSSLCRLQRIHSHMMSSRAEPEVLLEKVGCAGVITLNRPKFLNALTLNM
TRQIYPQLKKWEDDQEAAIVIIRGAGGKAFCAGGDIRAVTEAGKAGDALSEDFFREEYIL
NNAIGAYKKPYIALIDGITMGGGVGLSVHGRFRVATEKTLFAMPETAIGLFPDVGGGYFL
PRLQGKLGLFLALTGFRLKGRDVQRVGVATHFVESKHIPDLEKELVDLKSPSAEDVSNVL
QSYQNQSSLDSEKPFVLEKHLSDINRLFSSSSVEGIVQNLKADDSSFAKKQAETLSKMSP
TSMKITFRQLQAGATLSLSEVLVMEYRLSQACMRGCDFYEGVRAVLIDKDQSPKWNPPTL
EEVSHQMVEQSFSSLGHKDLTF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttatagttttaacgccgaagtacagactgagctctctctgcaggctgcagcga
attcactcccacatgatgtcaagtcgggcagaaccagaagttcttctggagaaagtgggt
tgtgcgggtgtgatcaccctaaacagaccgaaattcctaaatgccctgactctgaacatg
acccgtcaaatctaccctcagctcaagaaatgggaagatgaccaagaagctgctattgtg
ataatcagaggagcgggagggaaagccttttgtgctggtggagacatcagagcggtaacg
gaagcagggaaagcaggagacgctctctcggaggattttttccgtgaggaatacatcctc
aacaatgcaatcggagcctacaaaaaaccctatatagccctaattgatggaataacaatg
ggaggaggcgtgggcctgtcggtgcacgggaggtttcgagtggccacggagaagacgctg
ttcgccatgccggagaccgccatcggtctttttcctgatgtgggaggcggctattttctg
ccaaggctgcaggggaagctgggactctttctggccttgacgggcttccgtctgaaagga
cgtgacgtgcagcgggtcggcgtcgccacacactttgtggagtccaagcacatcccagac
ctggagaaggagctggtggacctgaagtctccgtccgctgaagacgtctccaacgttctg
cagtcgtaccagaaccagagctctctggactcggagaagccgtttgtcttggagaaacac
ctgtcagacatcaacaggctgttcagctccagcagcgtagagggcatcgtgcagaacctg
aaggccgacgactcgtcgtttgccaagaaacaagcggagacactgtccaagatgtccccc
acgtccatgaagatcaccttcaggcagcttcaggccggagcaactctgagcctgtccgaa
gtgttggtgatggagtatcggctgagccaggcgtgcatgaggggctgtgatttctacgag
ggcgttcgagccgtgttgatagacaaggaccagagtcccaagtggaacccccccacgctg
gaggaagtgtcccatcagatggtggagcagagcttctcctccctgggccacaaagacctg
acgttctaa

DBGET integrated database retrieval system