KEGG   Takifugu rubripes (torafugu): 101062000Help
Entry
101062000         CDS       T02386                                 

Gene name
hibch
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101062000 (hibch)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101062000 (hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101062000 (hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101062000 (hibch)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     101062000 (hibch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 382 aa AA seqDB search
MSFIVLTPKYRLSSLCRLQRIHSHMMSSRAEPEVLLEKVGCAGVITLNRPKFLNALTLNM
TRQIYPQLKKWEDDQEAAIVIIRGAGGKAFCAGGDIRAVTEAGKAGDALSEDFFREEYIL
NNAIGAYKKPYIALIDGITMGGGVGLSVHGRFRVATEKTLFAMPETAIGLFPDVGGGYFL
PRLQGKLGLFLALTGFRLKGRDVQRVGVATHFVESKHIPDLEKELVDLKSPSAEDVSNVL
QSYQNQSSLDSEKPFVLEKHLSDINRLFSSSSVEGIVQNLKADDSSFAKKQAETLSKMSP
TSMKITFRQLQAGATLSLSEVLVMEYRLSQACMRGCDFYEGVRAVLIDKDQSPKWNPPTL
EEVSHQMVEQSFSSLGHKDLTF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttatagttttaacgccgaagtacagactgagctctctctgcaggctgcagcga
attcactcccacatgatgtcaagtcgggcagaaccagaagttcttctggagaaagtgggt
tgtgcgggtgtgatcaccctaaacagaccgaaattcctaaatgccctgactctgaacatg
acccgtcaaatctaccctcagctcaagaaatgggaagatgaccaagaagctgctattgtg
ataatcagaggagcgggagggaaagccttttgtgctggtggagacatcagagcggtaacg
gaagcagggaaagcaggagacgctctctcggaggattttttccgtgaggaatacatcctc
aacaatgcaatcggagcctacaaaaaaccctatatagccctaattgatggaataacaatg
ggaggaggcgtgggcctgtcggtgcacgggaggtttcgagtggccacggagaagacgctg
ttcgccatgccggagaccgccatcggtctttttcctgatgtgggaggcggctattttctg
ccaaggctgcaggggaagctgggactctttctggccttgacgggcttccgtctgaaagga
cgtgacgtgcagcgggtcggcgtcgccacacactttgtggagtccaagcacatcccagac
ctggagaaggagctggtggacctgaagtctccgtccgctgaagacgtctccaacgttctg
cagtcgtaccagaaccagagctctctggactcggagaagccgtttgtcttggagaaacac
ctgtcagacatcaacaggctgttcagctccagcagcgtagagggcatcgtgcagaacctg
aaggccgacgactcgtcgtttgccaagaaacaagcggagacactgtccaagatgtccccc
acgtccatgaagatcaccttcaggcagcttcaggccggagcaactctgagcctgtccgaa
gtgttggtgatggagtatcggctgagccaggcgtgcatgaggggctgtgatttctacgag
ggcgttcgagccgtgttgatagacaaggaccagagtcccaagtggaacccccccacgctg
gaggaagtgtcccatcagatggtggagcagagcttctcctccctgggccacaaagacctg
acgttctaa

DBGET integrated database retrieval system