KEGG   Takifugu rubripes (torafugu): 101062000Help
Entry
101062000         CDS       T02386                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tru01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tru00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:tru00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:tru00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 452 aa AA seqDB search
MYGHNQGNQYPGYPNQPPAPGYPAVLAVARAMGTGMVTSTDMDTGMVMSTDMDMGMDTGM
DMGMSRVLATCCTFLLCSSPRLSSLCRLQRIHSHMMSSRAEPEVLLEKVGCAGVITLNRP
KFLNALTLNMTRQIYPQLKKWEDDQEAAIVIIRGAGGKAFCAGGDIRAVTEAGKAGDALS
EDFFREEYILNNAIGAYKKPYIALIDGITMGGGVGLSVHGRFRVATEKTLFAMPETAIGL
FPDVGGGYFLPRLQGKLGLFLALTGFRLKGRDVQRVGVATHFVESKHIPDLEKELVDLKS
PSAEDVSNVLQSYQNQSSLDSEKPFVLEKHLSDINRLFSSSSVEGIVQNLKADDSSFAKK
QAETLSKMSPTSMKITFRQLQAGATLSLSEVLVMEYRLSQACMRGCDFYEGVRAVLIDKD
QSPKWNPPTLEEVSHQMVEQSFSSLGHKDLTF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtacggccacaaccaaggaaaccaatatccaggttatccaaaccagccgcccgctcca
ggataccctgcggtcctggctgtggccagggccatgggcacgggcatggtcacgagcacg
gacatggacacgggcatggtcatgagcacggacatggacatgggcatggacacgggcatg
gacatgggcatgagcagggtccttgctacctgttgcacttttctgctttgctcttccccc
agactgagctctctctgcaggctgcagcgaattcactcccacatgatgtcaagtcgggca
gaaccagaagttcttctggagaaagtgggttgtgcgggtgtgatcaccctaaacagaccg
aaattcctaaatgccctgactctgaacatgacccgtcaaatctaccctcagctcaagaaa
tgggaagatgaccaagaagctgctattgtgataatcagaggagcgggagggaaagccttt
tgtgctggtggagacatcagagcggtaacggaagcagggaaagcaggagacgctctctcg
gaggattttttccgtgaggaatacatcctcaacaatgcaatcggagcctacaaaaaaccc
tatatagccctaattgatggaataacaatgggaggaggcgtgggcctgtcggtgcacggg
aggtttcgagtggccacggagaagacgctgttcgccatgccggagaccgccatcggtctt
tttcctgatgtgggaggcggctattttctgccaaggctgcaggggaagctgggactcttt
ctggccttgacgggcttccgtctgaaaggacgtgacgtgcagcgggtcggcgtcgccaca
cactttgtggagtccaagcacatcccagacctggagaaggagctggtggacctgaagtct
ccgtccgctgaagacgtctccaacgttctgcagtcgtaccagaaccagagctctctggac
tcggagaagccgtttgtcttggagaaacacctgtcagacatcaacaggctgttcagctcc
agcagcgtagagggcatcgtgcagaacctgaaggccgacgactcgtcgtttgccaagaaa
caagcggagacactgtccaagatgtcccccacgtccatgaagatcaccttcaggcagctt
caggccggagcaactctgagcctgtccgaagtgttggtgatggagtatcggctgagccag
gcgtgcatgaggggctgtgatttctacgagggcgttcgagccgtgttgatagacaaggac
cagagtcccaagtggaacccccccacgctggaggaagtgtcccatcagatggtggagcag
agcttctcctccctgggccacaaagacctgacgttctaa

DBGET integrated database retrieval system