KEGG   Takifugu rubripes (torafugu): 101062011Help
Entry
101062011         CDS       T02386                                 

Gene name
rxra
Definition
(RefSeq) retinoid X receptor, alpha
  KO
K08524  
retinoid X receptor alpha
Organism
tru  Takifugu rubripes (torafugu)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    101062011 (rxra)
   03320 PPAR signaling pathway
    101062011 (rxra)
Transcription factors [BR:tru03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    101062011 (rxra)
Nuclear receptors [BR:tru03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   101062011 (rxra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 496 aa AA seqDB search
METKPFLSLGFLKPQCSLAPPMDRGRSAEACSCFSGMCPLHQRRLASDSMGHVNSSPLGS
PTSHRGMHPSLLSPTSMGPSGSLHSPISTLSSPMNGLASPFSVISSPMGPHSMNSPGMGY
GASVSPQLNSPMNSVSSTEDIKPPLGINGVMKVPAQPSGTSLSLSKHICTICGDRSSGKH
YGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCVIDKRQRNRCQYCRYQKCLAMGMKREAVQ
EERQRAKDKNENEVESTSCASEDMPVEKILEAEQAVEPKTETYIETNLSVPSNSPNDPVT
NICQAADKQLFTLVEWAKRIPHFSELALDDQVILLRAGWNELLIASFSHRSIGIKDGILL
ATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNP
SEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTP
IDTFLMEMLEAPHQMT
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaacctttcttgtcattggggttcctcaagccccagtgctcactggctccc
ccgatggacagaggtcgctcggccgaggcctgttcctgtttcagtggcatgtgtcctctc
catcagcgccgcctagcctcagactcgatgggccacgtgaactcctcccccctgggctca
cccacatcccaccgagggatgcacccctcgctgctcagcccgacctccatgggaccctcc
ggctcgctccactcgcccatcagcacgctgagttcgcccatgaacggcctggcatcgccc
ttctccgtcatcagctcgccaatgggcccccactccatgaactcgcccggtatgggctac
ggcgccagcgttagccctcagctgaactcgccaatgaactcagtcagcagcactgaggac
attaagccaccgttgggcatcaatggtgtgatgaaggtgcccgcgcagccctcaggcacg
tcactgtcactcagcaaacacatctgcaccatctgtggtgaccggtcctcaggtaaacac
tacggggtatacagctgcgagggctgtaaaggcttcttcaaaagaacggtgcgcaaagac
cttacatacacctgccgtgacaacaaggactgtgtcattgacaagcgccagaggaaccgc
tgccagtactgccgctaccagaagtgtttagccatgggcatgaagagagaagccgtccag
gaggagcgtcagagagcgaaagacaaaaatgagaacgaggtggagtccaccagctgtgcc
agcgaggacatgcccgtggagaagattcttgaggccgagcaggcggtggagcccaaaacg
gagacctacatcgagaccaacctcagcgtgccatcaaactcgcccaacgatccagtgacg
aacatctgtcaggcggctgacaaacagctctttaccttggtcgaatgggccaagaggatc
cctcacttctccgagctggcactagacgatcaggtcatccttctacgagcaggttggaat
gaactcctcattgcgtcattttcgcaccgttcgatagggattaaagacgggatcctgctg
gcgacggggctgcacgttcatcgcaacagcgcccacagcgctggagtgggagccatcttt
gacagagtgctcacagaactggtgtcgaagatgagggacatgcagatggataagacggaa
ctggggtgtcttcgagctattgtccttttcaacccagactctaaaggcctgtccaacccc
agcgaggtagaagctctgcgagagaaagtgtacgcatctttagaggcttactgcaaacac
aagtaccccgaacagcctggcagattcgccaagctgttgctgcggttaccggcgctccgc
tccatcggcctcaagtgcctcgagcacttgttcttcttcaagctgatcggagacacgccc
atcgacaccttcctcatggagatgctggaggccccgcatcaaatgacataa

DBGET integrated database retrieval system