KEGG   Takifugu rubripes (torafugu): 101062018Help
Entry
101062018         CDS       T02386                                 

Definition
glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tru00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:tru03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 577 aa AA seqDB search
MNGTMAASSHRIMLGPLVAAIDQGTSSTRFLVFNSKTAELLSHHQVEIKQSFPKEGWVEE
DPKEILQSVYECMERTCEKLTQLNIDITNIKAIGVTNQRETTLVWDKETGEPLYNAIVWL
DLRTQSTVERLINKTPGRNKNHLKHRTGLPISTYFSAVKLRWLMDNVEEVREAVESHRAM
FGTVDSWLIWCLTGGKSGGVHCTDVTNASRTMLFNIHTLDWDPELCRYFGIPMEILPRVR
SSSEIYGLMKSGALSGIPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLRNTGTKPV
MSDHGLLTTVAYKLGRDKPAVYALEGSVAIAGAVVRWLQDNLGIIGSSEELEKLAASVGT
SYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKSHVAFAALEAVCFQTREILDAMNRD
SGIPLTQLQVDGGMTSNRLLMQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVSVWSL
NPEDLSEVTSEKSEPQINTEESEFRYTRWKKAVQKSMNWETTEPACNGNGESSIFSSMPL
GFYILGSMLMLVGAKYLAGGAIAQMLVPVLCDAFKNT
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaccatggccgcgtcttcacaccggataatgttggggccgctggttgctgcc
atcgaccaggggacgagctccactcggttcctggtgttcaactctaaaacggctgagctc
ctcagccatcaccaggtggagatcaagcagagcttcccaaaggaagggtgggtggaggag
gacccgaaagagatcctgcagtcggtgtacgagtgcatggagcgcacgtgtgaaaaactc
acccagctcaacatcgacatcacaaacattaaagcgatcggagtgacgaaccaaagggag
accaccctcgtttgggacaaagagaccggcgagcccctctacaacgccatcgtttggttg
gacctgcgaacgcaatcaacggtggaacgtctcatcaacaaaactccaggacggaacaaa
aaccacctgaagcacagaacggggctgccgattagcacgtactttagcgcggtgaagctt
cgctggctcatggacaacgtggaggaggtccgtgaagccgtggaatctcatcgcgccatg
tttggaaccgtggactcgtggctcatttggtgtttgacgggggggaagtccggtggagtc
cactgcacagatgtcaccaacgccagcagaaccatgctcttcaacatccacactttggac
tgggacccagaactttgccgatattttggtattcccatggagatcttgccgagagtgagg
agctcttcggaaatatacgggctcatgaaatctggcgctctgtcgggcatcccgatatca
gggtgccttggcgatcagtcagcggctctggtcggacagatgtgctttcaggacggacag
gcgaaaaacacatatggaactggctgtttcctcctcagaaacactggaacgaagcctgtg
atgtccgatcacggccttctgaccacggtggcgtacaaactgggtcgggacaaaccagct
gtctatgccctggagggttctgtggccatcgccggggccgtggtccgttggctacaggac
aatctggggatcatcggatcctccgaggagctcgagaagttggcggcgtccgtcgggacg
tcctacggctgttattttgttcctgctttctctgggctttatgctccatactgggagccc
agtgccagagggattatttgtggcttaactcagttcaccaataagagccacgtggcgttt
gcggcgctggaggccgtctgttttcagacacgtgagatcctggacgccatgaatcgggac
agcggcatcccgctgactcagctgcaggtagatggaggaatgacttccaacaggttgttg
atgcagctgcaggccgacatcctctgcattcctgtcgtgaagccgtcgatgcccgagacc
acggctctgggtgcagccatggcggcgggagcagcagagggggtgagtgtgtggagcctg
aaccctgaggacctgagcgaagtcacatcggagaagtccgagccgcagatcaacaccgaa
gagagtgaattccgctacactcgctggaagaaggcggtgcagaaatccatgaactgggaa
acgacagaaccagcctgtaatggaaacggggagagcagcatcttcagcagcatgccgctg
gggttctacatcctgggcagcatgttgatgctggtcggtgcaaaatatctggcaggagga
gcaattgctcagatgttggtacccgtgttgtgtgatgcgttcaagaacacgtaa

DBGET integrated database retrieval system