KEGG   Takifugu rubripes (torafugu): 101062018Help
Entry
101062018         CDS       T02386                                 

Definition
glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101062018
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101062018
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     101062018
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101062018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 577 aa AA seqDB search
MNGTMAASSHRIMLGPLVAAIDQGTSSTRFLVFNSKTAELLSHHQVEIKQSFPKEGWVEE
DPKEILQSVYECMERTCEKLTQLNIDITNIKAIGVTNQRETTLVWDKETGEPLYNAIVWL
DLRTQSTVERLINKTPGRNKNHLKHRTGLPISTYFSAVKLRWLMDNVEEVREAVESHRAM
FGTVDSWLIWCLTGGKSGGVHCTDVTNASRTMLFNIHTLDWDPELCRYFGIPMEILPRVR
SSSEIYGLMKSGALSGIPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLRNTGTKPV
MSDHGLLTTVAYKLGRDKPAVYALEGSVAIAGAVVRWLQDNLGIIGSSEELEKLAASVGT
SYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKSHVAFAALEAVCFQTREILDAMNRD
SGIPLTQLQVDGGMTSNRLLMQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVSVWSL
NPEDLSEVTSEKSEPQINTEESEFRYTRWKKAVQKSMNWETTEPACNGNGESSIFSSMPL
GFYILGSMLMLVGAKYLAGGAIAQMLVPVLCDAFKNT
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaccatggccgcgtcttcacaccggataatgttggggccgctggttgctgcc
atcgaccaggggacgagctccactcggttcctggtgttcaactctaaaacggctgagctc
ctcagccatcaccaggtggagatcaagcagagcttcccaaaggaagggtgggtggaggag
gacccgaaagagatcctgcagtcggtgtacgagtgcatggagcgcacgtgtgaaaaactc
acccagctcaacatcgacatcacaaacattaaagcgatcggagtgacgaaccaaagggag
accaccctcgtttgggacaaagagaccggcgagcccctctacaacgccatcgtttggttg
gacctgcgaacgcaatcaacggtggaacgtctcatcaacaaaactccaggacggaacaaa
aaccacctgaagcacagaacggggctgccgattagcacgtactttagcgcggtgaagctt
cgctggctcatggacaacgtggaggaggtccgtgaagccgtggaatctcatcgcgccatg
tttggaaccgtggactcgtggctcatttggtgtttgacgggggggaagtccggtggagtc
cactgcacagatgtcaccaacgccagcagaaccatgctcttcaacatccacactttggac
tgggacccagaactttgccgatattttggtattcccatggagatcttgccgagagtgagg
agctcttcggaaatatacgggctcatgaaatctggcgctctgtcgggcatcccgatatca
gggtgccttggcgatcagtcagcggctctggtcggacagatgtgctttcaggacggacag
gcgaaaaacacatatggaactggctgtttcctcctcagaaacactggaacgaagcctgtg
atgtccgatcacggccttctgaccacggtggcgtacaaactgggtcgggacaaaccagct
gtctatgccctggagggttctgtggccatcgccggggccgtggtccgttggctacaggac
aatctggggatcatcggatcctccgaggagctcgagaagttggcggcgtccgtcgggacg
tcctacggctgttattttgttcctgctttctctgggctttatgctccatactgggagccc
agtgccagagggattatttgtggcttaactcagttcaccaataagagccacgtggcgttt
gcggcgctggaggccgtctgttttcagacacgtgagatcctggacgccatgaatcgggac
agcggcatcccgctgactcagctgcaggtagatggaggaatgacttccaacaggttgttg
atgcagctgcaggccgacatcctctgcattcctgtcgtgaagccgtcgatgcccgagacc
acggctctgggtgcagccatggcggcgggagcagcagagggggtgagtgtgtggagcctg
aaccctgaggacctgagcgaagtcacatcggagaagtccgagccgcagatcaacaccgaa
gagagtgaattccgctacactcgctggaagaaggcggtgcagaaatccatgaactgggaa
acgacagaaccagcctgtaatggaaacggggagagcagcatcttcagcagcatgccgctg
gggttctacatcctgggcagcatgttgatgctggtcggtgcaaaatatctggcaggagga
gcaattgctcagatgttggtacccgtgttgtgtgatgcgttcaagaacacgtaa

DBGET integrated database retrieval system