KEGG   Takifugu rubripes (torafugu): 101062022Help
Entry
101062022         CDS       T02386                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101062022
   00670 One carbon pool by folate
    101062022
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     101062022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 198 aa AA seqDB search
MEAAKGNKKPVRVIAAVCNNRGIGKDNQMPWSIPAEFQYFLNTVTRVSRPGNMNMMVWGK
QCWVSHPDSTFPLPNILHAVLSKTLFTVPDHAHFLCESLDAAVRLASEPPLADLIEIIWI
VGGVQVYKEAMEHPRCDLIYLTDIMAEFECDVFFPEFDKKLFEVQDSFPDVPNGIQEDNG
IKYKCQVYKRKTAGKDQQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaagcggccaaagggaacaagaaacccgtgcgtgtcatcgcggcagtttgtaacaac
aggggcattgggaaagacaaccaaatgccctggagtataccggctgagttccagtatttc
ctgaacactgtgacgagggtgtcgagaccaggaaacatgaacatgatggtctgggggaaa
cagtgttgggtctcccatcctgactccaccttcccgttgcccaatattctgcatgcagtg
ctcagcaagacgctgttcactgtcccagatcatgcccactttttgtgtgaaagcttggat
gctgccgtccgcttggcctcagagcccccgctcgcagacctgattgagatcatctggatt
gttggaggagtgcaggtttacaaggaagcgatggagcacccgaggtgcgacttaatctac
ctgactgacatcatggcagagtttgaatgcgacgtcttcttccccgagttcgacaaaaag
ctgtttgaagtccaagacagttttccagacgtccccaacgggatccaagaggataacgga
atcaagtacaaatgtcaagtgtacaagagaaagactgcaggtaaagaccagcagtga

DBGET integrated database retrieval system