KEGG   Takifugu rubripes (torafugu): 101062175Help
Entry
101062175         CDS       T02386                                 

Gene name
hdac9
Definition
(RefSeq) histone deacetylase 9
  KO
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101062175 (hdac9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 626 aa AA seqDB search
MLQTIYEGESSFSTTEGRVGHQQLPNQGKMHNVNGSVDVKPDVPLCVEPLSPLDLRTDPR
MLGPGSDPGMWERQLQQELLLIQKQQQIQKQLLISEFQKQHEKLTRQHQAQLQEHLKLQQ
ELQAMKKQQELAEKERRLEQQQQQQQQQQNQQEKEQERHRREQHVSSLVLRGKERSRESL
TGAVASTEVKQKLQEFLLSKSAKDPISNGVSNSMIHHQNLWYTSSHHTSLDQSSPPLGGT
SPSCQYTLPSPVESKDDFPLRKTASEPNLKVRSRLKQKVAERRSSPMLKRRDGNIMTPYK
KRALELMDSTPTNSAPGSGPSSPIGASSALGAENGPSSLPTTTKTERWPSQPRLFRPEGS
VSMLSLYTSPSLPNISFGISTASSPISAAMALKDRSTEIKHGLPGQLLGSVPLQTGLESK
VSPSHQALLQHLLQKEQMRQQKMFSSGQSAMSSHPQSPLAMKDRPSSRPKIPKHRPLNRT
QSAPLPQNTLAQLVIQQQHQHFLEKQKQYQQQIHINKLLSKSIEQLRQPSAHLQESEEEQ
EEQQIREQMQRMQEDRVPPGGVIRKHTLSCSSGSSGELPDGHYGVIKVKEEPADSEDEGL
SNPSLESEHSAYLHQVKGRLVIRAMI
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagacgatttacgagggcgagtcaagtttctccacaacagaagggcgcgtcgga
caccagcagttacccaaccagggcaagatgcacaacgtgaacggctcagtggacgtaaag
cctgacgtgccgctgtgtgtggagccattatccccgttggacctgcgcactgatccgagg
atgctggggccaggctcggacccagggatgtgggagaggcagctgcagcaggagctgctc
ctcattcagaagcagcagcagatccagaaacagctgctcatcagcgagttccagaagcag
catgaaaagttgacccgtcagcaccaggctcagctccaggaacacctcaagcttcaacag
gagctccaggccatgaagaagcagcaggaactggcagagaaagagcgtcgtctggagcag
cagcagcagcagcagcagcagcagcagaatcagcaagagaaggagcaggagaggcaccgg
cgagagcagcacgtctccagcctggtgctcaggggcaaggagcgctctcgggagagtctc
acaggtgcggtggccagtacagaagtcaagcagaaactccaagagtttctgttgagcaaa
tcggcaaaggatccaatcagcaacggagtcagcaactccatgatccatcaccaaaatctc
tggtacacgtcctctcaccacacgtcgttggaccaaagctccccgcctctgggcggcaca
tccccctcctgccagtacactctgccatctccagtagagagcaaggatgacttccccttg
aggaagacagcgtccgagcccaacctgaaggtacgatccagactgaagcaaaaagtggca
gagagaaggagcagcccgatgcttaaaagaagagatggaaatatcatgactccttacaag
aaaagggctctggaattaatggactctacgcccactaacagtgcccctggctccggcccc
agctctcccataggggcttccagtgccttgggggctgaaaatggtccctcctctctgcct
actaccacaaaaacggagagatggccctcacagccaagactgttccgacctgagggctct
gtgtcgatgctgagcttatacacgtctccctctttacccaacatctcctttgggatttca
accgcatcttcgcccattagcgctgccatggcgttgaaggacagatcaacagaaatcaag
cacgggttgcccgggcagctgcttggatctgtgccacttcagacgggcctggagtccaaa
gtgagcccgagtcaccaggcgctcctgcagcacctcctccagaaggagcagatgaggcag
cagaagatgttctcctccggccaaagtgccatgtcgtcacaccctcagtcccccctggca
atgaaggatcggccctccagtcggccgaaaatacccaaacaccgacccttgaacaggacc
cagtctgcaccgctaccacagaacacgctggcccaactggtcattcagcagcaacaccag
cacttcctggagaaacagaagcagtatcagcagcagattcatatcaataagctgttgtcc
aagtccattgagcagctacgtcagccgagcgcacacctgcaggagtctgaggaagagcag
gaggagcagcagatcagggagcagatgcagcgcatgcaggaggacagggtgccccctgga
ggagtgatccggaagcacacgctgagctgcagcagcggctcaagcggcgagctccccgat
ggtcactacggggtcatcaaggtcaaagaggagccggctgatagcgaggatgaggggctg
tccaatccgagtctggagtcagagcacagcgcctaccttcatcaggtcaaaggaagatta
gtgataagagccatgatatga

DBGET integrated database retrieval system