KEGG   Takifugu rubripes (torafugu): 101062487Help
Entry
101062487         CDS       T02386                                 

Definition
(RefSeq) thrombospondin-1-like
  KO
K16857  
thrombospondin 1
Organism
tru  Takifugu rubripes (torafugu)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    101062487
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101062487
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101062487
  Cell growth and death
   04115 p53 signaling pathway
    101062487
  Cellular community
   04510 Focal adhesion
    101062487
Cell adhesion molecules and their ligands [BR:tru04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     101062487
Glycosaminoglycan binding proteins [BR:tru00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   101062487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
16
AA seq 1169 aa AA seqDB search
MKLTGIFLLLILWTCECTREAESRDDNSVYDLFELVQVPRKNHGVTLVKGDDPYSPAYKI
LNPDLIPAVPDNAFSDLIDSIHAERGFILMLNFKQFKRTRGSLLTVEKKDGSGPVFEVIS
NGKANTLDIVFSTENKQQVVSIEDVDLATSHWKNITLFVQEDQAQLYVGCEDVNTAELDA
PIHSILTQETPASARLRIGKGAVNDRFMGVLQNVRFVFGTTLDAILRNKGCQNSVTSETM
ILENLNGSSAIRTEYTGHKTKDLQMVCGFSCEDLISMFKELKSLGVVVKELSNELRQLTD
ENKLIKNRIGIHNGVCIHNGIMHKNRDEWTVDDCTECTCQNSATVCRKISCPVISCTNAT
IPDRECCPHCGTPSDSAEDSWSPWSEWTHCSASCGRGIQQRGRSCDRINNNCEGTSVQTR
DCYLQECDKRFKQDGSWSHWSPWSSCSVTCGAGVITRIRLCNSPMPQFGGKSCTGEGRQT
EKCQKSPCPINGNWGPWSPWDTCTLTCGGGVQIRKRLCNDPEPKHGGKECVGDAKDIQAC
NNKSCPIDGCLSNPCFAGVKCTSFHDGSWKCGKCPVGYSGNGVKCKDIDECKEVPDTCFK
FNGVHRCENTDPGYNCLPCPPRYSGPQPYGKGVEQAVAKKQVCTPRNPCLDGSHECNKNA
RCNYLGHFADPMYRCECKPGYAGNGHICGEDTDLDGWPNSDLICVENATYHCKKDNCPNL
PNSGQEDYDKDGIGDACDNDDDNDGIPDDRDNCPFVYNPRQYDYDRDDVGDRCDNCPYNS
NPDQTDTDNNGEGDACAVDIDGDGILNEKDNCPYVYNVDQRDTDLDGVGDMCDNCPLEHN
PDQVDSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDDDND
GIPDEKDNCRLAFNPDQLDSDGDGRGDVCKDDFDQDKVPDIYDVCPENVDISETDFRKFQ
MVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYHEFNSVDFSGTFFINTERDDD
YAGFVFGYQSSSRFYVVMWKQITQTYWSNKPTKAQGYSGLSIKVVNSTTGPGEHLRNALW
HTGNTAGQVRTLWHDPKNVGWKDFTAYRWHLIHRPRTGLIRVLMYEGKKIMADSGNIYDK
TYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3510 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgactgggatatttttgcttttaatactttggacctgcgagtgtacgagagag
gcagagagccgtgatgacaatagtgtctatgacttgttcgagctcgtccaagtccccagg
aagaaccacggggtcacgctggtcaaaggcgatgatccctacagccctgcctacaagatc
ctcaacccggacctgatccctgcggtccccgataatgctttcagtgacctcatcgactcc
attcacgccgaaagagggtttatcctgatgctcaatttcaagcagttcaagcgaaccagg
ggaagccttctcaccgtggagaagaaggatggctccggacccgtgtttgaggtcatctcc
aacggtaaagcgaacacgctggacatcgttttctccaccgagaacaagcagcaggtggtt
tccatcgaagatgtggacctggcgacgagccactggaagaacatcacgctgttcgtgcag
gaagaccaggcgcagctgtatgtgggatgcgaggacgtgaacacagccgagctggacgcg
cccattcatagcatcctgacgcaggagaccccggccagtgcgcggctgaggatcggcaaa
ggcgcagtgaatgacaggttcatgggcgtcctacaaaatgtgcgctttgtgtttggaacc
acactggatgccatcctccgtaacaaaggatgccaaaactctgttacaagtgaaactatg
atcctggagaaccttaatggctcctcagccatcagaacagagtacactggacacaaaact
aaagacctgcagatggtctgtggcttttcctgtgaggacctgatcagcatgttcaaggaa
ctgaagagtctcggcgtagtcgtgaaggaactgtccaatgagctccgtcagctgacagat
gagaacaagctgataaagaatcgcattggcatccacaacggcgtctgcatccataacgga
atcatgcacaagaacagagacgagtggacggtagacgactgcactgagtgcacttgtcag
aactctgctactgtgtgtcgcaagatctcctgtccggtgatctcctgtactaatgctact
atacctgatcgggaatgctgcccgcactgtggaacaccgagcgactctgcagaggacagt
tggtcaccatggtctgaatggacccattgttctgcgtcgtgtgggcggggcatccagcag
cgcgggcgctcttgcgatcgtatcaataacaactgtgagggcacctcagtgcagacccga
gactgctacctacaggagtgtgacaagcgattcaagcaagacggcagctggagtcactgg
tcgccttggtcatcttgctctgtcacctgtggtgctggtgtcatcacccgtatccgcctg
tgtaactcccccatgccccagtttggaggcaagagctgtactggagagggtcggcaaact
gagaagtgtcagaagtctccatgcccaatcaatgggaactgggggccctggtcaccatgg
gacacgtgcacactcacctgtggtggtggtgtccaaattcgaaagcgtctctgcaatgac
cccgaaccgaaacatggtggaaaagagtgtgttggtgatgccaaagacatccaggcttgc
aataacaagtcctgccctattgatggatgcctgtctaacccctgctttgctggagtcaag
tgcaccagttttcatgatggttcctggaagtgtggaaaatgccctgttggctacagtggt
aatggagttaagtgtaaagacattgatgagtgcaaagaggtacctgatacttgcttcaag
tttaatggtgtacaccgctgcgagaacacagatcctggttacaactgtctaccatgccct
cctcgttactcaggaccccaaccgtatggtaaaggtgttgagcaagctgttgcaaagaaa
caggtctgcactcctcgtaatccctgcctcgacggaagccacgagtgcaataaaaatgcc
cgctgtaactaccttggacactttgccgatcccatgtaccgttgcgaatgcaagcctggc
tatgctggcaatggccatatctgtggagaggacacggatctagatgggtggcccaattcg
gacctgatttgtgtggagaatgccacttaccactgcaagaaggataactgccccaacctt
cccaattcgggacaagaagattacgataaagatggtattggagatgcgtgtgacaatgat
gatgacaatgacggcattccagatgacagggacaactgcccatttgtgtacaaccccaga
cagtatgactatgaccgcgatgatgtgggtgaccgctgtgacaattgcccctacaacagt
aacccagaccagacagatacagataataatggagagggagatgcctgtgctgtggacatt
gatggagatggcatactgaatgagaaggacaactgtccctatgtgtacaatgttgaccaa
agagacacagaccttgatggtgtaggagacatgtgtgacaactgtcctcttgaacataat
cccgatcaggtggactcagatgacgaccgtgtaggagacaagtgtgacagcaaccaggac
atcgatgaggacggacaccagaacaatctggacaattgcccatacatacctaacgccaac
caggctgaccatgacaaggatggaaagggagacgcctgtgaccatgatgatgataatgat
ggcatccctgatgaaaaggacaactgcaggctcgccttcaatccagaccagctggactct
gatggcgatggtcgtggtgatgtctgcaaggatgattttgaccaagacaaagtgcccgac
atctatgatgtgtgccctgaaaatgttgacattagtgagacagacttccgtaaattccag
atggttcctttggatcccaagggcacatcgcagattgaccctaactgggttgttcgtcat
cagggcaaagagctggttcagacagtcaactgtgaccctggcattgctgttggttaccat
gaattcaattcagtggattttagcgggacgttcttcataaacactgagagggatgatgac
tatgcaggttttgtgtttggctaccagtccagctccaggttttatgttgtgatgtggaag
caaattacacagacatactggtcaaataaacccaccaaggcccaaggttattctggcttg
tccatcaaagtggttaactctaccaccggcccaggggagcacctcagaaatgccctctgg
cacacaggaaatactgcaggacaggttcgcactctctggcatgaccctaagaatgtagga
tggaaggactttactgcctacagatggcatctgatccacagaccgagaactgggctcatt
agggttttgatgtatgaaggcaagaaaatcatggctgattctggaaacatatatgacaag
acctatgcaggaggcaggctaggtctttttgtcttctcacaagagatggtatacttttca
gacctcaagtatgaatgcagagatgcctaa

DBGET integrated database retrieval system