KEGG   Takifugu rubripes (torafugu): 101062487Help
Entry
101062487         CDS       T02386                                 

Definition
thrombospondin-1-like
Orthology
K16857  
thrombospondin 1
Organism
tru  Takifugu rubripes (torafugu)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    101062487
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101062487
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101062487
  Cell growth and death
   04115 p53 signaling pathway
    101062487
  Cellular commiunity
   04510 Focal adhesion
    101062487
Heparan sulfate/heparin binding proteins [BR:tru00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  101062487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 1169 aa AA seqDB search
MKLTGIFLLLILWTCECTREAESRDDNSVYDLFELVQVPRKNHGVTLVKGDDPYSPAYKI
LNPDLIPAVPDNAFSDLIDSIHAERGFILMLNFKQFKRTRGSLLTVEKKDGSGPVFEVIS
NGKANTLDIVFSTENKQQVVSIEDVDLATSHWKNITLFVQEDQAQLYVGCEDVNTAELDA
PIHSILTQETPASARLRIGKGAVNDRFMGVLQNVRFVFGTTLDAILRNKGCQNSVTSETM
ILENLNGSSAIRTEYTGHKTKDLQMVCGFSCEDLISMFKELKSLGVVVKELSNELRQLTD
ENKLIKNRIGIHNGVCIHNGIMHKNRDEWTVDDCTECTCQNSATVCRKISCPVISCTNAT
IPDRECCPHCGTPSDSAEDSWSPWSEWTHCSASCGRGIQQRGRSCDRINNNCEGTSVQTR
DCYLQECDKRFKQDGSWSHWSPWSSCSVTCGAGVITRIRLCNSPMPQFGGKSCTGEGRQT
EKCQKSPCPINGNWGPWSPWDTCTLTCGGGVQIRKRLCNDPEPKHGGKECVGDAKDIQAC
NNKSCPIDGCLSNPCFAGVKCTSFHDGSWKCGKCPVGYSGNGVKCKDIDECKEVPDTCFK
FNGVHRCENTDPGYNCLPCPPRYSGPQPYGKGVEQAVAKKQVCTPRNPCLDGSHECNKNA
RCNYLGHFADPMYRCECKPGYAGNGHICGEDTDLDGWPNSDLICVENATYHCKKDNCPNL
PNSGQEDYDKDGIGDACDNDDDNDGIPDDRDNCPFVYNPRQYDYDRDDVGDRCDNCPYNS
NPDQTDTDNNGEGDACAVDIDGDGILNEKDNCPYVYNVDQRDTDLDGVGDMCDNCPLEHN
PDQVDSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDDDND
GIPDEKDNCRLAFNPDQLDSDGDGRGDVCKDDFDQDKVPDIYDVCPENVDISETDFRKFQ
MVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYHEFNSVDFSGTFFINTERDDD
YAGFVFGYQSSSRFYVVMWKQITQTYWSNKPTKAQGYSGLSIKVVNSTTGPGEHLRNALW
HTGNTAGQVRTLWHDPKNVGWKDFTAYRWHLIHRPRTGLIRVLMYEGKKIMADSGNIYDK
TYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3510 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgactgggatatttttgcttttaatactttggacctgcgagtgtacgagagag
gcagagagccgtgatgacaatagtgtctatgacttgttcgagctcgtccaagtccccagg
aagaaccacggggtcacgctggtcaaaggcgatgatccctacagccctgcctacaagatc
ctcaacccggacctgatccctgcggtccccgataatgctttcagtgacctcatcgactcc
attcacgccgaaagagggtttatcctgatgctcaatttcaagcagttcaagcgaaccagg
ggaagccttctcaccgtggagaagaaggatggctccggacccgtgtttgaggtcatctcc
aacggtaaagcgaacacgctggacatcgttttctccaccgagaacaagcagcaggtggtt
tccatcgaagatgtggacctggcgacgagccactggaagaacatcacgctgttcgtgcag
gaagaccaggcgcagctgtatgtgggatgcgaggacgtgaacacagccgagctggacgcg
cccattcatagcatcctgacgcaggagaccccggccagtgcgcggctgaggatcggcaaa
ggcgcagtgaatgacaggttcatgggcgtcctacaaaatgtgcgctttgtgtttggaacc
acactggatgccatcctccgtaacaaaggatgccaaaactctgttacaagtgaaactatg
atcctggagaaccttaatggctcctcagccatcagaacagagtacactggacacaaaact
aaagacctgcagatggtctgtggcttttcctgtgaggacctgatcagcatgttcaaggaa
ctgaagagtctcggcgtagtcgtgaaggaactgtccaatgagctccgtcagctgacagat
gagaacaagctgataaagaatcgcattggcatccacaacggcgtctgcatccataacgga
atcatgcacaagaacagagacgagtggacggtagacgactgcactgagtgcacttgtcag
aactctgctactgtgtgtcgcaagatctcctgtccggtgatctcctgtactaatgctact
atacctgatcgggaatgctgcccgcactgtggaacaccgagcgactctgcagaggacagt
tggtcaccatggtctgaatggacccattgttctgcgtcgtgtgggcggggcatccagcag
cgcgggcgctcttgcgatcgtatcaataacaactgtgagggcacctcagtgcagacccga
gactgctacctacaggagtgtgacaagcgattcaagcaagacggcagctggagtcactgg
tcgccttggtcatcttgctctgtcacctgtggtgctggtgtcatcacccgtatccgcctg
tgtaactcccccatgccccagtttggaggcaagagctgtactggagagggtcggcaaact
gagaagtgtcagaagtctccatgcccaatcaatgggaactgggggccctggtcaccatgg
gacacgtgcacactcacctgtggtggtggtgtccaaattcgaaagcgtctctgcaatgac
cccgaaccgaaacatggtggaaaagagtgtgttggtgatgccaaagacatccaggcttgc
aataacaagtcctgccctattgatggatgcctgtctaacccctgctttgctggagtcaag
tgcaccagttttcatgatggttcctggaagtgtggaaaatgccctgttggctacagtggt
aatggagttaagtgtaaagacattgatgagtgcaaagaggtacctgatacttgcttcaag
tttaatggtgtacaccgctgcgagaacacagatcctggttacaactgtctaccatgccct
cctcgttactcaggaccccaaccgtatggtaaaggtgttgagcaagctgttgcaaagaaa
caggtctgcactcctcgtaatccctgcctcgacggaagccacgagtgcaataaaaatgcc
cgctgtaactaccttggacactttgccgatcccatgtaccgttgcgaatgcaagcctggc
tatgctggcaatggccatatctgtggagaggacacggatctagatgggtggcccaattcg
gacctgatttgtgtggagaatgccacttaccactgcaagaaggataactgccccaacctt
cccaattcgggacaagaagattacgataaagatggtattggagatgcgtgtgacaatgat
gatgacaatgacggcattccagatgacagggacaactgcccatttgtgtacaaccccaga
cagtatgactatgaccgcgatgatgtgggtgaccgctgtgacaattgcccctacaacagt
aacccagaccagacagatacagataataatggagagggagatgcctgtgctgtggacatt
gatggagatggcatactgaatgagaaggacaactgtccctatgtgtacaatgttgaccaa
agagacacagaccttgatggtgtaggagacatgtgtgacaactgtcctcttgaacataat
cccgatcaggtggactcagatgacgaccgtgtaggagacaagtgtgacagcaaccaggac
atcgatgaggacggacaccagaacaatctggacaattgcccatacatacctaacgccaac
caggctgaccatgacaaggatggaaagggagacgcctgtgaccatgatgatgataatgat
ggcatccctgatgaaaaggacaactgcaggctcgccttcaatccagaccagctggactct
gatggcgatggtcgtggtgatgtctgcaaggatgattttgaccaagacaaagtgcccgac
atctatgatgtgtgccctgaaaatgttgacattagtgagacagacttccgtaaattccag
atggttcctttggatcccaagggcacatcgcagattgaccctaactgggttgttcgtcat
cagggcaaagagctggttcagacagtcaactgtgaccctggcattgctgttggttaccat
gaattcaattcagtggattttagcgggacgttcttcataaacactgagagggatgatgac
tatgcaggttttgtgtttggctaccagtccagctccaggttttatgttgtgatgtggaag
caaattacacagacatactggtcaaataaacccaccaaggcccaaggttattctggcttg
tccatcaaagtggttaactctaccaccggcccaggggagcacctcagaaatgccctctgg
cacacaggaaatactgcaggacaggttcgcactctctggcatgaccctaagaatgtagga
tggaaggactttactgcctacagatggcatctgatccacagaccgagaactgggctcatt
agggttttgatgtatgaaggcaagaaaatcatggctgattctggaaacatatatgacaag
acctatgcaggaggcaggctaggtctttttgtcttctcacaagagatggtatacttttca
gacctcaagtatgaatgcagagatgcctaa

DBGET integrated database retrieval system