KEGG   Takifugu rubripes (torafugu): 101062608Help
Entry
101062608         CDS       T02386                                 

Definition
bifunctional protein NCOAT-like
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101062608
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     101062608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 914 aa AA seqDB search
MVQNDKTTEAPPLGGEQSPNPVSGEVCAEAPGPVEEPGIAVETTGLRKFTSGVVEGFYGR
PWTMEQRKELFRRQQKWGLNTYLYAPKDDYKHRMFWRELYSVEEAEQLMTLISAAKEHAI
EFIYAISPGLDITFSNQKEVSALKRKLDQVTHFGCKSFALLFDDIDHNMCPADKEVFSSF
AQAQVSITNEIYQYLGEPETFLFCPTEYCGTLCYPNVAQSPYLRTVGEKLLPGIDVLWTG
PKVVSKDISVESIEEVSKILRRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVL
TNPNCEFESNFVAIHTLATWYKSNMNGVRKDVVMTDGEDSTVSIQIKLENEGSDEELETD
MLYSPQLALKLALTEWLGEFCVPRQYNSNQVSQGGIKGTAIDVSSMPPPSLCSSTTVTTV
FQQPIMSPAIPPLCLDQLPHPMAKVPQDEEEVEVEKKDSDEEPMEMVVEKMTDDPEVEKH
VGVILTEKMAEDLKPMDLDKENLAESKCPEEILQEDSGSDIAPMQTDDQVKQDMFVPGPD
EKPLFTAEPITIEDLNLLAELFYLPYEHGNKAVQMLREFNWLRANSSVVSVNCKRKESDK
VAEWQARAEKFEEMCCSVIQMFARLSNSANRTILYDLYPYIWDIKSIISMVKSFVQWLGC
RSQSSAQFLKGDQEPWAFRGGLAGEFQRLLPIDGANDLFYQPPPSMPTSKLYSIRPYFPK
DEAAVYKICKEMYCEGMEDIPVVEEPDLIGDRLVGGLLTLSSEYGFVLEDEEGICGYALG
TVDVKPFIKKCQMNWIPFMQEKYNKPDDQKDLTEAEKMMLSFHEEEEGLPESFLSKFPSL
IKVDIHAKVTDPSVAKSMMGCLLSSLKANGSLGAFCKVHQADKRMLDFYGKLGCFEVAKM
EGFPKDFIIMGRSL
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaacgacaagacgacggaggctcctccattaggcggtgagcagagccccaac
ccagtctccggagaggtttgtgccgaggcccccggcccggtggaagagcccggcattgca
gtcgaaacgacgggccttagaaaattcacaagtggagtcgttgaaggtttttacggtcgc
ccatggacaatggagcagagaaaagagctcttcagacggcaacagaaatggggactgaac
acatacctttatgcacccaaagatgattacaagcacaggatgttctggagagagctctac
tcagtagaggaagcagagcaactcatgaccttaattagcgccgctaaagaacatgcaata
gagttcatatatgccatttctcctggactggacataaccttttccaatcaaaaagaggta
tctgcacttaagaggaagcttgatcaggttactcactttggctgtaaatcatttgcctta
ctttttgatgacattgatcacaacatgtgcccagccgataaagaggtgttcagctcattt
gcgcaggctcaggtttcaattaccaatgagatctaccaatacctaggagagccagaaacc
ttccttttctgcccaacagagtactgtggaactctttgctacccaaatgtcgctcagtct
ccctacctccgtacagtaggagaaaagctactgcctggtattgatgtgctgtggacggga
ccaaaagtggtgtccaaagatatctcagtggagtctattgaggaagtatcaaaaatccta
agaagagcccctgtcatctgggacaacattcatgccaatgactatgatcagaagagactg
ttcttgggcccatataagggccgctccacagagctcattccaaggctgaagggagtcctc
accaacccaaactgtgaatttgagtccaactttgtagcgatccacactctggccacctgg
tacaaatctaatatgaacggagtacgcaaggatgtggtgatgactgatggtgaggacagc
acagtgtctatccagattaagttagaaaatgagggcagcgatgaagaattggagacagat
atgctctacagcccacagctcgctctgaagctggcccttacagaatggcttggggaattt
tgtgttcctcgtcaatacaacagcaatcaggtgtctcagggtggtatcaaaggcacagcc
attgatgtctcatccatgcctcctccctctctctgctcttccacaacagtcaccacggta
ttccagcagcccattatgtctccggccataccgcctctctgtctggatcaacttccacac
cctatggcaaaagttcctcaggacgaagaggaggtggaagtagagaagaaggactcagat
gaagagcccatggaaatggtggttgagaagatgacggatgatcctgaagtggagaagcac
gttggtgttatcctaactgaaaaaatggccgaggacctgaagcccatggatttagacaaa
gagaatttagcagagtcaaagtgccctgaagagatccttcaggaggactctgggagcgac
atcgcccccatgcagacagatgaccaggtcaaacaggatatgtttgtacctgggccagat
gaaaagcctctcttcacagcagaaccaatcacaattgaagacttgaacctgttggcagag
ctcttttatctgccttatgaacacggcaacaaggctgtgcagatgctgcgggagtttaac
tggctacgagctaacagcagcgtcgtcagtgtcaactgcaagcgcaaggaatctgacaag
gttgcagaatggcaagcaagagctgagaagtttgaggagatgtgctgttcagtcatccag
atgtttgcacggctatcgaattcagccaaccgcaccatcctctacgacctgtacccctat
atctgggacattaagagcatcatttctatggtcaagtcttttgttcagtggttagggtgt
cgtagtcagtcctcagcacaattccttaaaggagaccaagagccctgggcctttagggga
ggtctagcaggagagttccagagattgttgccaatagacggagcaaacgatcttttctac
caacctccaccttcaatgccaacatccaaactctattccataagaccttactttcccaaa
gatgaggcggctgtttataaaatctgtaaagaaatgtactgtgagggaatggaggatata
cctgttgttgaagaacctgacctcattggtgacaggttagtgggaggtctgctgacactg
agttcagagtacggctttgtgcttgaggatgaggaggggatctgtggctacgccctgggt
acagtggatgtcaagccattcatcaaaaaatgtcagatgaactggattcctttcatgcag
gagaaatacaacaagcctgatgatcagaaggatctcaccgaggcagagaagatgatgctg
agtttccatgaagaggaggaaggacttccagaatctttcctctccaaattcccctcgctc
atcaaggttgacattcacgccaaggtcacagacccaagtgtggccaaaagcatgatggga
tgtctcctgtcttctctcaaggccaacgggtctctgggtgccttctgtaaggttcatcag
gctgataagagaatgttggacttctatggtaaactgggatgttttgaagtggccaaaatg
gagggctttcccaaggattttatcataatgggacgcagtctgtga

DBGET integrated database retrieval system