KEGG   Takifugu rubripes (torafugu): 101062651Help
Entry
101062651         CDS       T02386                                 

Gene name
eif4e2
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 2
  KO
K03259  
translation initiation factor 4E
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101062651 (eif4e2)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    101062651 (eif4e2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101062651 (eif4e2)
Messenger RNA biogenesis [BR:tru03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     101062651 (eif4e2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101062651 (eif4e2)
Translation factors [BR:tru03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    101062651 (eif4e2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 236 aa AA seqDB search
MNNKFDALKDDDSGDHDQDQGSPKDGEKEKTEDEEKEQNVSKKKMVVPGAGEHPLQYNYT
FWYSRRTPGRPASTQSYEQNIKQIGSFASVEQFWRFYSHMIRPGDLTGHSDFHLFKEGIK
PMWEDDANKMGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIIS
IWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEDFHGLVNASGGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaatttgacgctctaaaagatgatgacagtggagatcatgaccaagaccaa
ggctcaccgaaagacggtgagaaggaaaaaactgaagatgaggaaaaggaacagaatgtc
tctaagaaaaagatggtggttccaggggcaggggagcacccacttcagtacaattacacc
ttttggtactccagacgtaccccgggaagaccagccagcacgcagagttatgaacagaat
ataaagcagattggcagttttgcctcggtggagcagttctggcgtttctatagtcacatg
attcggccaggtgacctgacgggacacagtgacttccaccttttcaaagagggtattaaa
cctatgtgggaggacgatgccaataagatgggtggaaaatggatcatacgtttgaggaag
ggcttagcctcccggtgctgggagaatctgatcctggcaatgcttggggagcagttcatg
gtcggcgaggagatctgtggggccgtggtatctgtacgcttccaggaggacatcatctcc
atctggaacaaaaccgccagcgatcaggccacaactgcgcgcatcagagacactctgcgc
agggtcctcaacctcccccccaacaccatcatggagtataaaactcatacagacagcatt
aaagcctgggaagacttccacggcctggtgaatgctagcggaggacgttag

DBGET integrated database retrieval system