KEGG   Takifugu rubripes (torafugu): 101062878Help
Entry
101062878         CDS       T02386                                 

Definition
histone H2B 3-like
Orthology
K11252  
histone H2B
Organism
tru  Takifugu rubripes (torafugu)
Brite
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101062878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 126 aa AA seqDB search
MPDPTKSAPAAKKGSKKAVTKTQKKGDKKRRKNRKESYAIYVYKVLKQVHPDTGISSKAM
SIMNSFVNDIFERIASEGSRLAHYNKRATITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatccaacgaaatccgcccctgcagcgaagaagggctccaaaaaggctgtcacg
aaaacacaaaagaaaggagataagaaacgacgtaaaaacaggaaggagagctacgccatt
tacgtgtacaaggtgctgaagcaggtgcacccagacacgggcatctcctccaaggccatg
agcatcatgaactcgtttgtgaacgacatattcgagcgcatcgccagtgaagggtcgcgc
ctggcgcactacaacaagcgcgccaccatcacctccagggagatccagaccgctgtgagg
ctgctgctgccgggggagctggccaagcacgccgtgtccgagggcaccaaggccgtgacc
aagtacaccagctccaaatag

DBGET integrated database retrieval system