KEGG   Takifugu rubripes (torafugu): 101062935Help
Entry
101062935         CDS       T02386                                 

Gene name
prkacb
Definition
(RefSeq) protein kinase, cAMP-dependent, catalytic, beta
Organism
tru  Takifugu rubripes (torafugu)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
20
AA seq 377 aa AA seqDB search
MAQGSFASRIFHKYCKNSQEHREPDSEVPHISEFTTMWEKLMKEFLAKAKEDFLRKWECP
QQCTTGLDDFDRFKTLGTGSFGRVMLVKHKETNQFYAMKILDKQKVVKLKQIEHTLNEKR
ILQAVSFPFLVRLVYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIILT
FEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSK
GYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLL
QVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYEKKVEAPFLPKCRGPGDTSNFDDYEEE
DVHVSQTEKCAKEFADF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcccagggatcgtttgccagccgcattttccacaaatactgtaagaatagccaagag
cacagagaaccagacagtgaggtgcctcacatttcagagttcaccaccatgtgggagaag
ctgatgaaagagttcttagctaaagccaaagaagattttttaagaaaatgggagtgtcct
cagcagtgcacaacaggcctggatgatttcgacaggttcaagactctgggaaccggctcc
tttggcagagtgatgctcgtcaaacacaaagaaacaaaccagttctatgcgatgaagatc
ttggacaaacaaaaagtggttaagttgaagcagatagaacacacattaaatgaaaagaga
atactacaggcggtctctttccctttcctcgtcagactggtctactctttcaaggacaac
tctaatctctacatggtgatggaatatgtgcccggtggggagatgttctcgcacctcaga
cgtattggaagattcagtgaacaccatgcaagattttatgcggctcagattatactgacc
tttgagtaccttcactccctggacctcatctacagagacctgaagcctgaaaacctgctc
atagatcagcaggggtatattcaggttacagactttggatttgccaaaagagtaaaaggt
cgaacctggacgttgtgtggaactccagagtacctggctccagagatcatccttagcaag
ggctacaacaaagctgtggactggtgggccctcggagttcttatctacgaaatggctgct
ggttaccctcctttttttgccgatcagcccatccagatctacgaaaagatcgtgtctggc
aaggtacgatttccctcccactttagctccgacttgaaggatctgctgaggaacctgctg
caggttgacctgacgaaaagatttggcaacctgaagaacggcgtgaacgacatcaaaaac
cacaagtggttctccacaacagattggatcgccatatatgagaaaaaggtggaagcgcct
tttttgccaaagtgccgaggacccggagacacgagtaacttcgatgattacgaagaggag
gatgttcacgtctcgcagacggaaaagtgcgcgaaagagtttgctgatttttag

DBGET integrated database retrieval system