KEGG   Takifugu rubripes (torafugu): 101063025Help
Entry
101063025         CDS       T02386                                 

Definition
(RefSeq) cytosolic 10-formyltetrahydrofolate dehydrogenase-like
  KO
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    101063025
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     101063025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 890 aa AA seqDB search
MKIAVIGQSLFGQEVYKELRKDGHTIVGVFTIPDKDGKADPLATEAEKDGVPVFKFPRWR
VKGQAIPEVVDQYARTGAELNVLPFCSQFIPMEVINRPKHGSIIYHPSLLPRHRGASAIN
WTLIHGDQKGGFTVFWADDGLDTGPILLQRECHVDPDDTVNTIYKRFLFPEGVKGTVEAV
KLIAEGKAPRITQPAEGATYECIQKKDNAKIDWNQTAEALHNWIRGNDKVPGAWAEVDGQ
KVTFYGSSLLDNGAAATGQPLEIPGASRPAVVTKSGLVLFGNDGKSLLVRNLQFEDGKMI
SAAQYFSSGSSAAVELTEEEGRFAEQMRAVWQSILSNVSRIEDATDFFKAGAASMDVVRL
VEEVKLRASSCQLQNEDVYMNTTFRDFIQMCVRKLRGEDGEEELVVHYVEKDINNMSVKM
PHQLFINGEFVDAEGXKTYKSINPTDACVDKAVAAAKEAFEEGEWGKMNPRDRGRLIYRL
ADLMEEHQEELATIEAMDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGSTIPINQARP
NRNLTFTKKEPIGVCAIVIPWNYPLMMLAWKTAACLAAGNTVVLKPAQVTPLTALKFAEL
AARAGLPKGVVNILPGSGALVGQRLSDHPDVRKLGFTGSTEIGKQIMKSCAVSNVKKVSL
ELGGKSPLIIFSDCDMDKAVRMGMSSVFFNKGENCIAAGRLFVEETIHDQFVKKVVEEVK
KMKIGDPLDRSTDHGPQNHKAHLDKLVEYCQTGVKEGATLVCGGRQVQRAGFFFEPTVFT
DVRDHMFIAREESFGPVMIISKFKSGEVDQVLRRANDTEYGLASGVFTRDISKALYVSEK
LNAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGQEALNEYLKTKAVTIEY
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccgtgattgggcagagtctgtttggccaggaggtgtacaaggagctgagg
aaggacggccacaccatcgtgggggtcttcaccatcccagacaaggacggaaaggccgac
cccctggcaaccgaagcagagaaggacggcgtccctgttttcaaattcccccgctggcgt
gtgaagggtcaggccatccccgaggtggtggaccagtacgcccggaccggagccgagctc
aacgtgctgccgttctgttctcagtttattcccatggaggtcatcaaccggcctaagcac
ggctccatcatctaccacccgtctctgctgcctcgccacaggggggcgtcggccatcaac
tggacgctgatccacggagaccagaaaggaggattcacggtgttctgggccgacgacggc
ctggacaccgggcccatccttctgcagagggagtgccacgtcgaccccgacgacacggtc
aacaccatctacaagaggttcctcttcccggagggagtcaaaggcaccgtcgaagcagtg
aagctgattgcagaaggaaaggcgcccaggataacgcagccagcagagggcgccacatac
gagtgcattcagaagaaagacaacgctaagattgactggaaccagactgctgaggccctt
cacaactggatcagagggaatgacaaagtgcccggtgcctgggcggaggtggacggacag
aaggtaaccttctatggctccagtctgctggacaatggtgctgcagccacaggacaaccc
ctggagattcctggagccagccgaccggctgtcgtcaccaagtcgggcctggttctcttc
ggcaacgatgggaagtccctgctggtgaggaacctccagtttgaggacgggaagatgatc
tcggctgcgcagtacttcagctccgggagcagcgctgccgtggagctgacggaggaggag
ggacgcttcgcggagcagatgagggcggtgtggcagagcatcctgagcaacgtgagccgc
atcgaggacgccaccgacttctttaaggcgggggctgcttccatggacgtggtcagactt
gtggaggaggtgaagctccgggccagtagctgccagctgcagaacgaggacgtctacatg
aacaccacctttcgggatttcatccagatgtgcgtcaggaagctcagaggagaggacggt
gaagaggagttggtggtccactacgtggagaaggacatcaacaacatgagcgtgaaaatg
cctcaccagctcttcatcaacggagaatttgtggacgcggaggganngaagacttacaag
agcatcaaccccaccgacgcctgcgtggacaaagccgtcgcggccgccaaggaggcgttt
gaggagggggagtggggcaagatgaaccccagagaccgaggccgtctcatctacaggctg
gcagacctgatggaggagcaccaggaggagctggccaccatcgaagccatggattcgggg
gctgtttacactctggccctgaagactcacgtcggcatgtccatccagaccttccggtac
ttcgctggctggtgcgacaagatccaaggcagcaccatccccattaaccaggcccggccc
aaccgtaacctgaccttcaccaagaaggaaccaatcggagtctgtgcgattgtgattccc
tggaactaccccctgatgatgttggcctggaagactgcagcctgcctggcggctggaaac
acagtggtcctcaaacctgctcaggtgacgccactcacagcactgaagtttgccgagtta
gcagcaagggcgggactgcctaaaggagtcgttaacatccttcctggatcgggtgctctg
gtgggtcagcgcctgtccgaccaccccgacgtccggaaactgggcttcacgggctccacc
gaaatcgggaagcagatcatgaaaagctgtgcagttagcaacgtgaagaaggtctctctg
gaactgggagggaagtctcctctcatcatcttcagcgactgtgacatggacaaggccgtg
cgcatgggaatgagctcggtgttcttcaacaaaggagagaactgcatcgcggccggcagg
ctgtttgtggaagaaaccatccacgaccagtttgtgaagaaagtggtggaagaggtgaag
aagatgaagatcggcgacccgctggaccgctccacagaccacgggcctcagaaccacaaa
gcccacctcgacaagcttgtggaatattgccagactggcgtcaaggagggcgccaccttg
gtgtgcggtgggaggcaggtgcagcgggcagggttcttcttcgagcccacggtgttcacc
gacgtacgagaccacatgttcatcgctcgggaggaatcgttcggccccgtcatgatcatt
tcaaagttcaagagcggtgaggtggaccaggtgctgaggagggccaacgacaccgagtac
ggcctggcgtcgggggtcttcacgcgggacatcagcaaagctctctacgtcagtgaaaag
ctgaacgccggcacggttttcatcaacacctacaacaagacggacgtggcggcaccgttc
ggaggcttcaaacagtccggctttggcaaagacctgggtcaagaggctctcaacgaatac
ctgaagaccaaggcagtcaccatcgagtactag

DBGET integrated database retrieval system