KEGG   Takifugu rubripes (torafugu): 101063087Help
Entry
101063087         CDS       T02386                                 

Definition
mitogen-activated protein kinase 4-like
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101063087
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101063087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 589 aa AA seqDB search
MAKLDTPITLHGFDLGGHFVDLRPLGVGVTGLVLSAVDQRTGQRVAIKKLVMRDVVTVKH
ALREVKITQRLHHENVVKVHEVAAPFGRPLPRDPTQLSALYIVQECMETDLARLLEQGPL
DTDHATLLFYQLLRGLKFIHSANVLHRDLKPANIFINTDQLLLKIGDFGLARIVDPHYSH
KGYLSEALVTKWYCSPRLLLSPNNYTKAIDMWAAGCILAEMLTGHMLFAGAHELEQMQLI
LDTVPVLREEDRQDLLQVMPSYVSHGWKVKKPFRDLLPEVDSQAVDFLEHILTFNPMDRL
TAEAALSHPFLLQYSCLEDEPTSLHPFRIEDELEDSLITEQSLSNSNSQASSMHWERYGN
SLSTDVSWQQSGSSCHCMPPSCGTSDLGDATEDEEVQRDPRASSTLLLEEAQVDPRKYSH
SSSAERFLENSHSSLDRACGLGYGDLDCSHSCDYKVGSPSYLDKIAWREGKPQHYSEPKL
ILDLSHWKQMKKEESEEEEETGDLFQEISRWPANGDSLESLPVKQRERMFDLDVFISRAL
KLCRQNKEKGDHRRGKEGGWKEENKQSGIPQKMVRLPEHLTPPSQAPNL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcttgacacccccattacactccacggcttcgacctgggcggccactttgtc
gaccttcgacctctcggtgttggtgtgaccggtctggtgctgtctgctgtggaccagcgc
actggacagcgtgtggccattaagaagctggtgatgcgcgatgtggtgacagtaaaacac
gctctgcgggaggttaagatcacccagcggctgcaccacgaaaacgtggtgaaagtccac
gaggtggcggccccatttggacggccgctgcccagagaccccacccagctgagcgccctc
tacatcgtccaggagtgcatggagacagatctggctcggctactggagcaagggcccctg
gacacagatcacgcaacgctgctgttctaccagctgctgcgggggctgaagttcatccac
tctgctaatgtcctgcacagagatctaaagcctgccaacatattcatcaacacagaccag
ctcctgctcaagatcggagattttgggctggccaggattgtcgaccctcattattcccat
aagggctacctgtccgaagcgttggtaactaagtggtattgctccccccgtctgctcctg
tcccccaataactacaccaaggccatagacatgtgggctgccggctgcatactggctgag
atgctcactggacacatgctgtttgcaggggctcatgagctggagcagatgcagctgatt
cttgacactgtgccagtgctgagagaggaggacaggcaggaccttttacaggtgatgcct
tcatatgtcagtcatgggtggaaagtgaagaagccctttcgtgacttgctgccagaagtg
gattcacaagctgtggacttcctggaacatatcttgaccttcaaccccatggacaggtta
acggcagaggcagccctgtcccaccccttcctcctgcagtactcctgcctggaggacgag
cccacgtctctgcatccgttccgcatcgaggacgagctggaggacagcttaatcaccgag
cagagccttagtaacagcaacagtcaagcgtccagcatgcactgggagaggtacggcaac
agtctatcaacagatgtgtcctggcagcagtcaggcagcagttgtcactgtatgcccccc
agttgtggtacctctgacctaggtgatgccactgaggatgaggaggtgcagagagacccc
cgggccagctccaccttgctgttagaggaggctcaggtcgatccacgcaagtattcccac
agcagctcggcagagcgttttctggagaactctcactcctcactggaccgggcctgcggt
ttaggctatggggacctcgactgcagccactcgtgcgactacaaagttggctcgccttcg
tatctggataaaattgcctggagggagggcaagcctcagcactactcagagccaaagctc
atcctcgatctgtctcactggaagcagatgaagaaggaggaatcagaggaggaggaggag
acaggggatttatttcaggaaatctcccgctggccagcaaacggtgactctctggagtca
cttcctgtcaagcagagggaacggatgtttgacctggatgtgttcatatcacgagcgctg
aagctgtgcaggcaaaataaggagaaaggcgatcacaggagaggaaaagagggaggctgg
aaggaagaaaataagcagagcggcatcccccagaagatggtgaggcttccagagcacctg
actccaccatcacaggcacccaacttatga

DBGET integrated database retrieval system