KEGG   Takifugu rubripes (torafugu): 101063216Help
Entry
101063216         CDS       T02386                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 1-like
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101063216
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101063216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 265 aa AA seqDB search
MDALLSALFSSEKEELYILDCLAYFMVFMAACCFVTLLFENVPYGRYSTSKYGFPVNAKV
AWFIQELPAFLVPFSLLVWTSSARTSLLPNQLLIAMYFCHYVQRALIYPFLIRGGKPTPF
VSFALAFVFCVYNGYMQIRYLSHYAVYPAHWFTHPCFITGSVLWFTGWLVNVHSDHILRN
LRQPGESGYKIPTGGMFEYVSGANFLGEITEWVGFALAGHSVHSAAFAVFTAVVLASRAV
AHHKWYLAKFENYPKQRKALIPFLF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggacgccttactttccgcgctgttttcctctgaaaaggaggaactgtacattttagac
tgcttggcttactttatggttttcatggcagcctgctgtttcgttactttgcttttcgaa
aatgtgccatacggacgatattctaccagcaagtatggattcccagttaatgccaaagtt
gcatggttcattcaggagcttcctgcgttccttgttcctttcagcctgcttgtttggaca
tcttcagcgagaacgtcattattacccaaccagctgctaattgctatgtatttctgtcac
tacgttcaaagggctcttatttatccgttcttaatccgaggaggtaaaccaacaccgttc
gtctcatttgctctggcctttgttttctgcgtctataatggatacatgcagatcagatac
ctgagtcactatgctgtttatcctgcacactggttcacacatccatgttttatcacaggc
tctgtgctgtggttcacggggtggctggtaaatgtgcactctgaccacatcctcaggaac
ctgagacagccgggagagtcgggatacaagattcccacaggtggaatgtttgaatatgtg
tcaggagcaaacttccttggagagataacagagtgggtcggcttcgctctggccggacac
tcggttcacagcgcagccttcgccgtcttcaccgcagtggtcctcgccagcagagctgtg
gcccaccacaaatggtacctggctaagtttgaaaactaccccaaacagaggaaggctttg
attccttttcttttttga

DBGET integrated database retrieval system