KEGG   Takifugu rubripes (torafugu): 101063256Help
Entry
101063256         CDS       T02386                                 

Definition
maltase-glucoamylase, intestinal-like
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101063256
   00500 Starch and sucrose metabolism
    101063256
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101063256
    3.2.1.20  alpha-glucosidase
     101063256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1820 aa AA seqDB search
MGKRRFSGFELTLIVLFLLMLGVTIALIVLFLTQRPASSGDKDEGPTFMPKCPSLPLNER
VDCFPDAGASKQQCEKRGCCWSPLDERNVPWCFFPTNHGYLVESIQQQSPYEMRATMKRM
ASPSLFGADVEELLFYAEMQSENRLRFKIYDGQKKRFEVPHEHVSSLISNKSRPLNNVLE
VKNQPFGLTVRRTDSEKVLFDTTFAPLVFADQYLQLSAKLPSHNIYGLGEHVHRQYRHDT
NWKTWPIFTRDGFPNGGTHNLYGHFPFFLCLEDESGKSFGVFLMNSNAMEVTLQPAPAVT
YRTIGGILDFYIFFGDTPEKVVQEFLELIGRPVIPPYWSLGFQLSRWNYGSLKEVKTTVE
RNRAVELPYDVQYTDIDYMEDKKDFTYDRVKFDGLPEFADYLHVKGQKYILILDPAIATS
RRVGNTSYDSFDRGTEKNAWVFESDGKTPLLGEVWPGETVFPDYTSESCIEWWVDEYERF
SREIKHDALWIDMNEVSNFKKGSVKGCVDNKLNYPPYTPKILDKVMYSKTLCMDAQQAWG
SHYDVHSLYGYSMVLASERALKRVFGGNRTLMLTRSSFPGIGKYSGHWLGDNAANWNDIK
WAIPGMLEFGLFGVPYIGADICGFFDNSSEELCRRWMQVGAFYPFSRNHNAEGYEPQDPA
FYGPNSPLVASSKYYLRIRYTLLPYLYTLFYKAHTTGDTVVRPVMHEFYSDSNTWSTDRQ
FLWGKHLLITPVLDPGVDTVKAYIPDAVWYNYETMEQLAERRMHVTMHLPADKLGLHVRG
GAILPTQEPDVTTTHSRRNPMGLLVALDDNKQAAGELFWDDGDSRETVETGKHIHYLFSV
SSGQLKMQVTRAGYKDPNNLTFENITILGVSYPPNSSAVSLISGEGSPTTSLPHTMQYDA
EKKILFLQGLSLTLGESYLVKWDQGLEDYQRFDCHPEDNGDETKCKSRGCIWKPSSIEKA
PWCFYPDDYGYSVTAFNETSSGMTADIVRNKKYRSSGRPNSPDIDTLRVSIQYHTSHMLQ
FKIVDPATDRYEVPVPLSLPGTSETDESKRLYKVAITQMPFGIKVTRKSTGIAIWDSSVP
GFTFSEMFIQVSTRLPSHFIYGFGETEHPTYKHDLNYHTWGMFTKDQPPGYKTNSYGMHP
FYMGLEKTADAHGVLLLNSNAMDVTLQPTPALTYRTVGGILDFYMVLGPTPEMVVQEYTQ
LIGRPVLPAYWTLGFQLCRYGYANDSEIEDLYNSMRAAGIPYDVQYADIDYMDRQLNFVL
DSEFSKLPALVERIQDEGGRFIIILDPAISGNETVPYPAFDRGVADDVFIKWPKNLSDEI
VWGKVWPDYPNVTVNDSLDWDTQIELYRSYTAFPDFLRPATAKWWFQEIKDFYDKIMKFD
GLWIDMNEPVTFVSGTVGKKCLGDPLFENPPYMPALESRYLGLNHKTLCMNSEQILSDGK
KVRHYDVHSLYGWSQTQPTYDAMLNVTGKRGIVVTRSTFPSSGKWAGHWLGDNTAGWDQL
YKSIIGMMEFSLFGISYTGADICGFFNDAEYEMCLRWMHLGAFYPYSRNHNGKGFRRQDP
VAWDAQFANYSRDVLNIRYSLLPYLYTLMFEAHTKGSTVIRPMLHEFVQDTNTWNIHKQF
LWGPAMLITPALDKGVVNVEGYIPDARWYDFHTTREIGVRRQNLIMPTPLHHINLHVRGG
YILPWQKPENTTHFSRKNPLGLIVALSDNGTAQGSLFWDDGEGVDNVDRGRYLLTSFTAE
SNMLSSQVLVNGLHVTDQPFLGVLKLWGAGTTKIISASLISDNGEWTLTPEHNMDTQELI
IDATSLSASMSQPFSVTWRI
NT seq 5463 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaacggcgcttctctgggtttgagctgaccctgattgtcctgttcctcctgatg
ttgggggtgaccatcgccctcatagttttgtttttgacacaaagacctgcgagcagtggc
gataaagatgaaggacccacgttcatgcctaagtgtcctagtctgcccttaaatgaaaga
gtggactgtttccccgatgccggagcttcaaagcaacagtgtgaaaaaagagggtgttgc
tggagcccgctagatgagagaaacgttccgtggtgcttctttcccaccaaccatggctac
ttggtggaatccatacagcagcaaagtccgtatgaaatgagagccacaatgaagagaatg
gcctcgccatcattattcggcgccgatgtagaagagctgttgttttacgcagaaatgcag
tctgaaaatcgtctgcgttttaagatctatgacggacagaagaagagatttgaggttccc
catgagcacgtcagcagcctcatcagcaacaagagtagacctctgaacaatgtgctggag
gtgaaaaatcaaccttttggcctcacagtccgccggacagacagcgagaaagtcttgttt
gacaccacatttgctcctctggtgtttgcggaccagtatctacagttgtctgctaaactg
ccatcccataatatttatggcctgggagagcacgtacatagacagtatcgccatgatact
aactggaagacctggcctatcttcaccagggatggtttccctaatgggggaacccataac
ctctacggacattttcccttctttctctgccttgaagatgagagtgggaagtcctttggt
gtcttcctcatgaacagcaacgccatggaggtgactttgcagcctgctcctgctgtgacc
tacaggaccatcggaggcattcttgacttctatattttcttcggggacactcccgaaaag
gtggttcaggagttccttgagctgattggccggccagtcattcctccctactggtcactg
ggtttccagctgtctcgatggaactacggtagcctgaaagaggtgaagaccacggtggag
agaaaccgcgcagtggagcttccctatgacgttcagtacaccgacatcgattacatggag
gataagaaagatttcacttacgatagagtgaagtttgatggcctgcctgagtttgcagac
taccttcatgtaaagggtcagaaatacatcctcatcctggatcctgcaattgcaacaagt
aggagggtggggaatacctcctatgactctttcgaccgggggactgagaagaacgcctgg
gtgttcgagtctgatgggaagacgccattgttgggagaggtgtggccaggtgagacggtc
tttccggactacaccagtgaaagctgcatcgagtggtgggtggatgaatacgagcgcttc
tccagagagatcaaacacgatgccctctggattgacatgaacgaggtgtctaatttcaag
aaaggatctgtgaaaggatgtgttgataacaaactcaactaccctccatatactccaaag
attctggacaaggtgatgtacagcaagaccttgtgtatggacgcccagcaggcgtggggg
agccattacgacgtccacagtctctatgggtattctatggtgctggcctctgagagagca
ctaaagcgtgtgtttggagggaatcgcaccctgatgttgacacgctcctccttcccaggc
atagggaaatattcaggccactggcttggagacaatgccgccaattggaatgacatcaaa
tgggctatcccaggaatgctggagtttggactctttggtgttccctatatcggggcagac
atctgtggattcttcgacaactccagtgaagagttgtgtcgtcgatggatgcaggtgggg
gctttctaccccttcagccggaaccacaacgccgaaggctacgagccacaggatccagct
ttttatggcccaaactcaccgctggtggcaagctccaagtattacctgaggatccgttac
acacttctgccttacctgtacacgctcttctacaaagcccacaccacaggagacactgtg
gttcggccagtcatgcatgagttctactctgacagcaacacctggagcaccgaccgccag
ttcttgtggggaaaacacctgctgatcacacctgttctggacccgggtgtggacactgtg
aaggcgtacatcccagatgctgtgtggtacaactatgaaacaatggaacaactggccgag
cgcagaatgcatgtcaccatgcatctgccagccgacaagctcggtttacacgttcgaggt
ggggccatcctcccaacacaggaacctgatgtcaccacaacacacagccggcgtaacccc
atgggattgttagttgccctggacgacaacaagcaggcagcaggagagttgttctgggat
gatggagactctagagaaaccgttgaaacaggcaaacacatccactacctgttctcagtc
agctcaggccagctgaaaatgcaggtgacccgtgcaggctacaaggacccaaacaacctg
acgtttgagaatataaccatccttggggtctcgtacccccccaactcctctgcagtctct
ttaatcagtggagaaggaagtcctaccacctccttgccacacaccatgcagtacgatgct
gagaaaaagattctgttcctgcaaggactttccctaaccctcggagaaagctacctggtc
aagtgggaccagggactagaggattatcaacgctttgattgccatcctgaggacaatgga
gatgaaaccaagtgcaagtccagaggctgcatctggaagcccagcagcattgaaaaggct
ccctggtgcttctaccccgatgattatggctacagtgttacagcattcaacgaaacctcc
agtggcatgacagctgacatcgtacggaataaaaagtatcggagcagtggtcgcccgaac
tccccagatatcgacacgttgcgtgtcagcatccaataccacaccagtcacatgctgcag
ttcaagatcgtggatcctgctacagatcgttatgaggttccagtgccgctgtcactaccc
gggacctcagagactgatgagagcaagaggctctataaggttgctattacgcagatgcct
tttgggatcaaggtcacaaggaaaagcacgggaatcgcgatctgggactcatctgtgcca
ggatttaccttctcagaaatgtttattcaagtgtccactcgtctgccgtcacactttatc
tatggcttcggtgagacagaacatcccacctacaaacacgacctcaactatcacacctgg
ggaatgttcaccaaggaccaaccaccgggttacaaaaccaattcctatggaatgcatccc
ttttatatgggtctggagaaaacagccgatgctcacggcgtcctgctgctgaacagtaat
gccatggatgtgactttgcagccaactccagcgttaacctacagaacagtcggaggcatc
ttggatttctacatggtcctgggacctacgccagaaatggtggtgcaggagtacacacaa
ctgataggacgacccgtactacctgcctattggactctggggttccagctctgtcgctat
ggttatgccaatgactcagaaatagaagatctgtacaacagtatgagggctgctggtatc
ccctatgatgtgcagtatgctgacattgactacatggaccgccaactgaactttgtcctt
gattcggaattctccaagttgcctgcactggtggagcgcattcaggatgagggcggcaga
tttattattattctggatccagcgatctccggcaatgagacggtcccttaccccgccttt
gacaggggagtggccgatgacgttttcatcaagtggcccaaaaacctcagtgatgaaatc
gtatggggaaaggtgtggccagattatccaaacgtcactgtgaatgactcactggactgg
gatacccagatagagttatacagatcttacactgctttccctgacttcctgcgacctgcc
acagcaaagtggtggtttcaagaaatcaaggacttctatgacaagatcatgaagtttgac
ggcttgtggattgacatgaatgaacctgtcactttcgtctctggtacggttggaaaaaaa
tgtcttggtgatccactttttgaaaaccctccttacatgccagctttggaaagcagatat
cttggcctaaaccacaagacactgtgcatgaacagtgagcagatactcagtgatgggaag
aaagtgcgacactacgatgtccacagcctgtacggatggtcccagacccagcctacctat
gatgctatgctgaacgtgacaggcaagagaggcattgtggtgaccaggtccaccttccca
tccagtggaaaatgggctggacattggctgggagacaacactgcaggctgggaccagtta
tacaaatctataataggcatgatggagttcagcctgtttggtatctcttatactggggct
gatatctgtggcttcttcaatgatgccgagtatgaaatgtgtcttcgctggatgcacctg
ggtgcattttacccttactcacgcaaccacaatggcaagggattccggagacaagaccct
gttgcctgggatgcccagtttgccaattattcccgggatgtcctgaacatccgatactct
ctcctgccgtatttgtacacactgatgtttgaagctcacaccaaaggaagcactgtcatc
agacccatgttgcatgagtttgtccaggatacaaacacctggaatatccacaaacagttc
ctctggggacctgccatgctgatcacacccgccctcgacaagggagtcgtaaatgtggag
ggttacattcctgatgctcgctggtacgacttccacacgaccagagagattggagtccgc
cgccaaaaccttatcatgcctacacctttgcaccatatcaaccttcatgtccgcggtgga
tacatcctaccctggcagaaaccggagaacaccacccacttcagtcggaagaatccttta
gggctgatcgttgccctaagtgacaatggtactgctcaaggatcactcttctgggatgat
ggagagggagtagacaacgttgacaggggacgatacctgctgacttccttcacagcagag
tcgaacatgctgtccagtcaggtcctggtcaacggtctgcacgtgacagaccagcccttc
ctgggagtgttgaaactttggggtgcgggaaccacaaagatcatatcagcaagtctgatt
tcagataatggggaatggactctgacccctgaacacaacatggacacacaggagctgatt
atcgacgccacaagcctgtcagctagcatgtctcaacctttcagtgtgacatggaggatc
tga

DBGET integrated database retrieval system