KEGG   Takifugu rubripes (torafugu): 101063291Help
Entry
101063291         CDS       T02386                                 

Definition
(RefSeq) dual specificity protein kinase CLK2-like
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     101063291
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   101063291
Spliceosome [BR:tru03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    101063291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
12
AA seq 523 aa AA seqDB search
MPHNRRHSSTDRDSRSSYQDRYRDRGRRHRHRRSPTYSSSSDRDRRGRGYRQEGSYARSR
SRSYGNRSVEHRPFDRRCWEGYRRLDHSRDRDREREPHGVAEGYYQRDFSPDMYDYRRGR
ERDRERAESYRRKGSRRKHKRRRRRTRSYSPSSSRSNSRTRALSVRDDEEGHLICRTGDV
LQERYEIVGTLGEGTFGRVMECIDHRRGGVHVALKIIKNVEKYKEAARLEINVLEKINEK
DPDNKFHCVQMYDWFDYHGHMCISFELLALSTFDFLKENNYLPYSIVQVRHMAYQLCLAV
KFLHDNKLTHTDLKPENILFVNSDFTMSYNVEKKREERTVKNTGVRVVDFGSATFDHEHH
STIVSTRHYRAPEVILELGWSHPCDVWSIGCILFEYYVGFTLFQTHDNREHLAMMERILG
PVPSRMIRKTRKQKYFYRGRLDWDDNSSAGKYVRDNCKPLRRYLLSEAEEHHQLFDLIES
MLEYEPSKRLLLADALKHPFFERVGFGEAASSKTWEANRDISR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcctcataatcgacggcactcgtctacagaccgagacagtaggagcagctatcaagac
cgctacagagacagaggacgaagacaccggcaccggaggtcgccgacctactcctccagt
agtgacagggacaggaggggacgaggttaccgacaagaaggaagctatgcacgctcgagg
agccgcagctacggcaatcgctccgtggagcaccggccgtttgacagaaggtgctgggag
ggatacagacgcttggatcacagccgggatcgtgaccgggaaagagagccccacggagtg
gccgaaggttactaccaacgcgacttttctccagacatgtacgactaccggcgaggccgc
gagagggatcgcgagcgggctgaatcgtaccggaggaaaggcagcaggcgtaagcacaaa
agaaggcggcgtagaacaaggtcctatagcccatcgtcctcgcggagcaacagccggacg
agggcactgagtgtgagggacgacgaggaagggcacctgatctgtcggactggtgacgtc
ctgcaagagagatatgagattgttggcactttgggtgagggcacctttggcagagtgatg
gagtgcatcgaccaccgcaggggaggagttcacgttgctctgaaaattatcaagaacgtg
gagaagtacaaggaagcggctcgtctggagatcaacgtgctggagaagatcaatgaaaag
gatcctgataataaattccactgcgtgcagatgtatgactggttcgactaccacggacac
atgtgcatctccttcgagctcttggctctgagcacctttgattttctaaaagaaaacaac
tacctgccgtactcgatcgttcaagtgcggcacatggcctatcaactgtgtcttgctgtg
aagtttctccatgacaataaattgacacacacagacctcaaacctgagaacatcctcttt
gtcaattctgacttcacgatgtcctacaacgtagagaagaagcgagaagagcgaacggtg
aagaatacgggagtccgtgtggtcgactttggcagtgcgacgtttgaccacgagcaccac
agcaccatcgtgtccacgcgacattaccgcgcccctgaggtcatcctagagctgggctgg
agccatccctgtgatgtgtggagcatcggctgcatcctgtttgaatattatgtgggattt
actttgttccagacgcacgacaacagggagcacttggccatgatggaaagaattctgggc
ccggttccgtctaggatgatccgaaagacgaggaagcagaagtatttctatcgcggccgc
ctggactgggacgacaactcttcagcggggaaatatgtcagagacaactgtaaaccctta
cggcgttacttgttatcggaggccgaggagcaccaccagctgtttgacctcattgaaagc
atgctggagtacgagccttccaaacggctgctgctggctgacgccctgaaacacccgttc
tttgaaagagtgggctttggcgaggcagcgagcagcaaaacctgggaggctaatcgagac
atcagccggtga

DBGET integrated database retrieval system