KEGG   Takifugu rubripes (torafugu): 101063351Help
Entry
101063351         CDS       T02386                                 

Definition
serine/threonine-protein kinase NLK2-like
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tru04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:tru04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tru04068]
Cellular Processes; Cell communication; Adherens junction [PATH:tru04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 475 aa AA seqDB search
MAFHGSGRQTVCGDLFPASELGTKYFCVSSSCGAPSTGLSATPCLTGPTAPAGTPRHPTA
LGGSAGGGAAVPQPYSNPASEVPSPAEMEPDRPIGYGAFGVVWAVTDPRDGRKVALKKMP
NVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVI
VSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEE
PDPSCHMTQEVVTQYYRAPEVLMGCRHYGSAIDIWSVGCIFAELLGRRILFQAQSPIQQL
DLITDLLGTPPLSALSSACEGARAHILMGPHKPPSLSVLYMLSDGATHEAVHLLCRMLVF
DPAKRISGSDALSHPYLDEGRLRYHTCMCQCCYSVPSGRVYTRDFEPVAERPFSHSYENS
LLSVWQGKELIHRFITEHQQGKRVPLCINPQSAAFKTFIRSTAWHSSKVSRKEER
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcacggctcgggccgacagaccgtctgcggcgacctgtttccggcctccgaa
ctgggcaccaagtacttctgtgtcagctcctcctgcggagccccctccacgggcctcagc
gcgaccccgtgcctgaccggacccactgccccggcagggaccccccgccaccccaccgct
ctgggcgggagcgccggcggcggagcggcggtgcctcagccctacagcaacccggccagc
gaggtgcccagccccgcagagatggagcccgaccggcccatcggatacggcgccttcggc
gttgtctgggccgtgacggatccgcgggacgggcgcaaagtcgctttaaagaagatgccc
aacgtcttccagaacctggtctcctgtaagagggtcttcagagagctgaggatgctgtgc
ttcttcaaacacgacaacgtcctctcggccctggacatcctgcagcctcctcagatcgat
tgcttcgaggagatatacgtcatcacagagctgatgcagagcgacctccacaaagtgatc
gtgtccccgcagcccctcaccaccgaccacatcaaggtgttcctctaccagatcctcaga
ggcctgaagtacctgcactccgctgggattctgcaccgggacatcaaacccggaaacctg
ctggtcaacagcaactgtctgctgaagatttgtgactttggcctggctcgggtggaggag
cccgacccgtcgtgtcacatgacccaggaggtggtgacgcagtactacagagcgccggag
gtgctgatgggctgccggcactacggctcggccatcgacatctggtcggtgggctgcatc
tttgcggagctgctggggagacgcatcctcttccaggctcagagccccattcagcagctg
gatctgatcacggacctgctggggacgccgcctctgtcggccttgtcgtcggcctgtgag
ggggcccgggcccacatcctgatggggccacacaaaccaccgtcgctgtcggtgctctac
atgctgtcggacggcgccacgcacgaggccgtgcacctgctctgccgcatgctggtcttc
gatccggccaaacggatctccggcagcgacgcgctctcccacccgtacctggacgaaggg
cgcctgcgctaccacacctgcatgtgtcagtgctgctactccgtccccagcgggcgagtt
tacacgcgtgactttgagccggtggcggagcggccgttcagtcacagctacgagaacagc
ctgttgtctgtgtggcagggcaaagagttgatccaccgcttcatcacggagcaccagcag
gggaagcgcgtgccgctgtgcatcaacccccagagcgctgcgttcaagaccttcatcagg
tccacggcctggcactcgtccaaggtgtccaggaaggaggagagatga

DBGET integrated database retrieval system