KEGG   Takifugu rubripes (torafugu): 101063468Help
Entry
101063468         CDS       T02386                                 

Gene name
whsc1l1
Definition
(RefSeq) Wolf-Hirschhorn syndrome candidate 1-like 1
  KO
K11425  
histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101063468 (whsc1l1)
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101063468 (whsc1l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 1549 aa AA seqDB search
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEGTCDTGSDPGEDGGPSYDAALDSEFSYPP
SASEDMSQVSNGYPPGLGLYEPQAKFSMYSQFPNGSANGYGAIRSYGEHGLLPGEGTVLR
GPGLQERPLSPVSPPLSTHHPHLHHHHHHHAHHYHSNQPHIQTHPHTQSPPPPPSQHHLS
QTPHIMTHTLPHPPPLHLPSSSPPPSLVDSTPSSQPSHAPSNTSGGVLKKTSSPEIKLKI
IKTYQNGKELFESALCGDLLEELQESQKKEASQTQRRHERKKEKRKKSARLQLQVQEQSL
NQSQTQAGTLTLPDDTNMHPQLVEMPQTEKPQKTTVKTVPKTPKVPKVHHQSVIQETGFC
KEFVIGDLVWSKVGTYPWWPCMVSSDPQMKVHTRINTRGHREYHVQFFGSVAERAWIHEK
RIVIYQGKQQFEDLQAETLRKATNPVEKQKLMKPIPQRERSQWEVGVGHAEDAFVMTRQE
RIDNYTFIYVDPDPNEAPPSKKPNIRAEKQNRRSSGSVRKEEGGVKSPDREQPPRRQLPR
RQCSVSNTDDSTNSQASNDDHRESQHSATSPKQSVGCDVQDQQDSPPPVRAWKTAAARKL
LPLSITMKRLNVEITKCDWPLLQKKAALSPKNDSDEKEERVEREARQPDLGYCSPEQECR
AKPEPSLEEDEDGDEGEEESDDRRGSPASQKSEEGDMQQMYSPGSHHSSPQGSQERKLQR
RSVRSRSESERGSDPVPKKKTKKEQAEIAPETTLRTGSQKGASEISDACKPLKKRSRAST
DVEMASSQYRDTSDSDSRGLSDPQGLFGKNLDSPAAADGSDTQSVDSGLSRQDSNTDKRD
TVCQICEAYGESLVVCEGDCNRQFHLECLGLTAQPEGRFICLECQNGDHPCFSCKTAGQE
VTRCSVSGCGCYYHEDCVRKLLGTTSSPGGGFCCPQHICSTCCLERDLQRASKGRLMRCI
RCPVAYHTGDSCVAAGSVVLTHHIMICSSHGSTKRNGLLTSPINVSWCFLCARATKKNVG
KGGKLLCCDSCPASFHPECLEMEMPEGPWSCSDCRTGKKPHYKQIVWVKLGNYRWWPAEI
CNPRLVPSNIQSLRHDIGDFPVFFFGSHDYYWINQGRVFPYVESDKNFVTGQININKTFK
KALEEAARRFQELKAQRESREALEQERNSRKPPPYKFIKSNKPVGKVQMHVADLSEIQRC
NCRPTDEHPCGLHSQCLNRMLQYECHPQVCPAGDNCENQGFTKRLYAETEVVKTADRGWG
LKANQPLKKGEFVTEYVGEVIDAEECQQRIKRAHENHMTNFYMLTLTKDRVIDAAQKGNL
SRFINHSCSPNCETQKWTVNGDVHIGLFALCDIDAGTELTFNYNLHCVGNRRTTCNCGSD
NCSGFLGVQPTSAVVLEKEEKARNAKLKPKKRKLRLEGKHTHEYYCFCCGEGGELVMCDR
KDCPKAYHLLCLNLTKPPYGRWECPWHDCTICSAPASSSCDFCPRSFCQEHEEGALTSSS
LEGRLCCSSHDPASPLGSNSCSTQPHCSTSSPLRVKEEPETETDPMAAE
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atggatttctccttttctttcatgcaagggatcatgggaaatacaattcagcaaccccct
caactcattgactcagccaacatcagacaggaaggcacctgtgacaccggcagtgacccg
ggtgaggatggtggaccctcatatgatgctgccctggactcagagttttcctaccctcca
tcggcctcagaggacatgtcgcaggtctcgaacggctacccgccaggtctgggcttgtat
gagccacaggccaaattctccatgtactcacagttccccaacggctcagctaacggctac
ggggcaattcgaagctatggagagcacggtctcctgccaggggaagggaccgtcctgaga
gggcccggccttcaggagagaccgctgtcccctgtctccccccctttgtccacgcatcac
ccacacctccatcatcaccaccaccatcatgcacaccactaccactcaaaccaacctcat
atacaaacccatccgcacacacagagccctccaccgccgccctcccagcaccacttgtcc
cagacgcctcacatcatgacccataccctcccccatcctcccccattacacctgccttcc
tctagtcctcctccctcacttgtggacagtaccccctcctcccaaccttcacatgcaccg
tccaacacctcgggtggggtactaaagaaaaccagttccccagagatcaagctgaaaatt
ataaagacttatcaaaatggaaaagagctgtttgaatctgcgctgtgcggagaccttctc
gaagagctacaggagtctcagaagaaggaagcttctcagacacagcgcagacatgagcgg
aagaaggaaaagaggaaaaagagtgcaaggctgcagctgcaagtgcaagaacagagtctg
aaccagagccaaacgcaggcgggtaccttaaccctgccggacgacaccaacatgcaccct
cagctcgtagaaatgccgcagacagagaagcctcagaagaccactgtcaaaactgtacca
aagacaccaaaggttccaaaggttcaccatcagtccgtaattcaagagacgggcttctgt
aaggagtttgtgataggagatctggtgtggtccaaagtgggaacctatccatggtggccc
tgcatggtctcttctgacccacagatgaaggtccacacccgtataaacaccaggggtcac
agagagtaccatgtccagttctttggtagtgttgctgagcgagcctggatccacgaaaag
agaatagtcatatatcaaggaaagcagcagttcgaagaccttcaggcagaaacgctgcgc
aaggcaacaaaccctgtcgagaaacaaaaacttatgaagccgattcctcagcgggagcgt
tctcagtgggaggtgggcgtgggccatgctgaggatgccttcgtaatgacacgccaggag
cggattgacaactacaccttcatctacgtggacccagacccgaatgaagcccctcccagt
aaaaagcccaacattagagcagagaaacaaaatcggcgctcaagcggctccgtgcgtaag
gaggagggaggtgtgaagtcaccagatagggagcagccgcctcggcgacagcttccacgc
agacaatgcagcgtttcgaacacagacgacagcacaaactctcaggcttcaaatgatgac
catagggagagtcagcattcagctacctctcctaaacagagtgtaggttgtgacgtacaa
gaccagcaggactcgccgccgccagttcgagcctggaaaacggcagcagccaggaaactg
ctgcctctctccatcaccatgaagcggcttaatgtagagataacaaagtgtgactggcct
cttctgcagaaaaaagctgctctctctccaaaaaatgactcggatgaaaaagaggagaga
gtggagagagaggccaggcagcctgacctgggctactgctcccctgagcaggagtgcagg
gctaaacctgagcccagccttgaggaagatgaggatggggatgaaggagaggaagagagt
gatgacaggagagggtcacccgccagtcagaagagcgaagagggagatatgcagcagatg
tactctcctggatcacaccacagcagtccgcagggttcccaggaaaggaagttgcagcgg
agatcagtcagaagcaggtctgagtcagagagaggaagcgatcccgtccctaagaagaaa
accaaaaaggaacaggcagagattgctccagagaccaccctgaggaccggttcacagaaa
ggtgccagcgaaatatccgatgcctgcaagcctctgaagaaacgaagcagagcgtcaaca
gatgtcgagatggcttcttctcagtacagagacacatctgattctgattccagaggactt
agcgatccacagggtttatttggtaagaatcttgatagtccagctgcagcagacggctca
gacactcagtcggtggactctggtttgtcccgtcaggacagcaacactgacaagagagac
accgtctgccagatctgcgaggcgtatggagagagcctggtagtgtgtgagggtgactgc
aacagacagtttcacctggaatgcctcggtctgacggcccaacctgaaggcagattcatc
tgtttggaatgtcaaaatggcgatcatccctgtttcagctgtaaaacggcaggtcaggaa
gtgacgcgctgttctgtgtctggatgtggttgttattaccatgaggactgtgtccggaaa
ctcctgggcaccaccagcagtccaggcggaggattttgctgcccccagcacatctgttct
acctgctgcttggagagagatttgcaaagagcaagtaaaggccgtctgatgcgatgtatc
cgctgtccagtggcctatcacacaggggatagctgtgtggcggcaggcagcgtcgtcctc
acccatcacatcatgatctgcagcagtcatggcagcaccaagaggaacggcctcctcact
tcccccatcaacgtgagctggtgcttcctgtgtgccagagctaccaaaaagaatgttggg
aaaggaggcaagttgctgtgctgcgactcatgcccggcttccttccacccggaatgtctg
gagatggagatgcctgaagggccgtggtcctgcagtgattgcaggacagggaagaaaccc
cactacaaacaaattgtttgggtcaaactgggaaactataggtggtggccagctgagatt
tgcaatcctcgcctggttccatcaaacattcagagcctccgccacgacataggggacttc
cctgtcttctttttcggctcccacgactactactggatcaatcaaggccgcgtctttccc
tacgtggagagtgacaagaactttgtcactggtcagatcaacatcaacaaaaccttcaag
aaagctctggaagaagcagcccgtaggtttcaggagctcaaggcgcagagggagagtagg
gaagctctcgagcaggagcgcaactcacgcaaacctccgccctacaaatttattaagtct
aacaagccagtgggaaaagtacagatgcacgtagcagacttgtcagaaatccagcgatgc
aactgcagaccgacagatgagcatccttgcggccttcattcccagtgtctcaaccgcatg
ctgcagtatgagtgtcatccacaggtgtgtcctgcaggagacaactgtgagaaccagggt
ttcactaaacgcttgtacgcagagacagaagtggtcaagacagctgaccgtggttggggc
ctcaaggcaaaccaacccctcaagaagggtgagtttgtgacagagtatgtgggtgaggtg
atagacgcagaagagtgccagcagcgaatcaaacgcgcccatgaaaaccacatgaccaac
ttctacatgctcactctcacaaaggatcgggtcatagacgccgcgcaaaagggcaacttg
tcgcggtttataaaccacagctgcagcccaaactgtgaaacacagaagtggacggtaaac
ggcgacgtacacatcggactcttcgccctctgtgacatcgacgccggtacagagttgaca
ttcaactacaacctgcactgtgtcggcaacaggagaaccacttgtaactgcggctcagac
aactgttccggattcctcggagtgcagccgacgagtgctgtggtgttggagaaagaggag
aaggccagaaatgccaagttgaagcccaagaagcggaagttgcgattggagggcaaacac
actcatgaatactactgcttttgctgtggggagggtggagagctggtgatgtgcgacagg
aaggactgtccaaaggcataccacctgctgtgtctaaacctcaccaagccaccatacggg
cgctgggaatgtccatggcatgactgtaccatctgcagtgcaccggcgtcttcctcctgc
gatttctgcccacgctccttttgccaggagcacgaggaaggggcactcacctcctcctcg
ctcgaaggccgtctctgctgctccagtcacgaccctgctagtccattggggtccaactcc
tgctctacccagccacactgctccacctccagcccgctcagagtgaaagaggagccagag
acagagacggacccaatggctgccgagtga

DBGET integrated database retrieval system