KEGG   Takifugu rubripes (torafugu): 101063503Help
Entry
101063503         CDS       T02386                                 

Definition
tyrosine-protein kinase SYK-like
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101063503
Protein kinases [BR:tru01001]
 Tyrosine protein kinases
  Syk family
   101063503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 555 aa AA seqDB search
MDDKVNTLPFFYGEITREEAEDYLQQAGMVNGLYLLRQSRNNLGGFALSVSFSDRCYHYS
IERRANETYAIPGGKTHRHPVDVIDYHSQVTDGLVSLLKRPCNRPKNMRPKVGLFEDMKE
KLIREYVQQTWNLQGAALEQAIISQRPKLEKLIATTAHEKMSWFHGAITREDSEPRLQNG
VRPNGKFLVRQRDQSSYALCIIHEGQVMHYRIDQDQIGKLSIPDGKKFDTLWQLVEHYSY
KPDGLLHILTEPCPRHAGENDAMPMDTEVYESPYADPDELRSSTVDRSQLILEDGELGSG
NFGTVMKGIYKMRKTEKSVAVKILKNDDNNASVREEMLREANVMQQLDNPYIVRMIGICE
AESLMLVMELADLGPLHKFLQKHKQISMKNITELVHQVSMGMRYLEEHKFVHRDLAARNV
LLVTQHYAKISDFGLSKAVAEEKNYYKAKGHGKWPVKWYAPECINYFKFSSKSDVWSFGV
LMWEAFSYGQKPYKGMKGNEVMQMIESGQRMDAPVNCPSEMYDLMRACWTYKVEGRPEFT
VVEPRLREYYYDISH
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaaagtgaacacattacccttcttctatggtgaaatcacaagggaagaagca
gaggactacctgcagcaggccggcatggtcaacggcctgtacctcctacgacagagccga
aacaacctgggagggtttgcgctctctgtctccttctcagaccgctgctaccattacagc
attgaaagacgagccaatgaaacatacgctattcctggggggaagacccacaggcaccct
gtggatgtgattgattaccattcccaggtgacggatggcctggtgtcgttgctgaagagg
ccctgcaacaggcccaagaacatgagaccaaaggttggactgtttgaggacatgaaggag
aagctgatccgagagtatgtgcagcagacatggaacctgcagggtgcagctctggagcag
gctattatcagccaaaggcctaagctggagaagttgattgccaccaccgcacatgaaaag
atgtcttggtttcatggagcaataacgcgagaagactctgagcccaggcttcaaaatggc
gtccgccccaatggaaagttcctggttcgtcagagggaccagagctcatatgctctgtgt
atcatccacgaaggacaggtcatgcattaccgcattgaccaggaccaaataggcaaactg
tccataccagatggaaagaagtttgacaccctgtggcagctagttgaacattattcatac
aagcccgatggtctgctgcacattctaacagaaccctgtccaagacacgctggagagaac
gatgcaatgccaatggatacagaggtgtatgagagcccctatgcagacccagacgagctg
aggagctccacagtggatcgtagtcagcttatcctggaggatggagaactgggctctggg
aactttggtaccgttatgaaaggcatctacaaaatgaggaagacggagaagtcagtggct
gtcaaaatcctgaagaacgatgacaacaacgcatcagtgcgtgaggagatgctgcgagaa
gccaacgtcatgcagcagctggacaacccctacatcgttagaatgatcggaatctgtgag
gccgagagcctcatgctggtcatggagctggctgatctgggaccactgcataagttcctg
cagaaacacaagcaaatcagcatgaagaacatcaccgagctggtccaccaggtgtctatg
gggatgaggtacctggaggaacataagtttgtccacagggacctcgctgccaggaacgtc
ctgctggttacgcagcactatgccaagatcagcgacttcggcctgtccaaagctgttgct
gaggagaagaactactacaaggctaagggtcatgggaagtggccagtcaaatggtacgct
cccgaatgcatcaactacttcaagttttcatccaaaagtgatgtttggagctttggggtg
ctgatgtgggaagccttctcctacggccagaaaccttacaagggaatgaaaggaaatgag
gtgatgcagatgattgaaagtggacagcggatggatgctcctgtcaactgtccatcagag
atgtacgacctgatgcgggcctgctggacatacaaggtggagggcagacctgagttcacc
gtggtggagcccagattacgggaatattactacgacatctcccattaa

DBGET integrated database retrieval system