KEGG   Takifugu rubripes (torafugu): 101063899Help
Entry
101063899         CDS       T02386                                 

Gene name
ncoa1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101063899 (ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 1475 aa AA seqDB search
MSAVGENPLDPATSEARKRKGSPCDTSGPSLEKRRRELECRYIEELAELLSSNMGDIASL
SVKPDKCHILKSTVDQIQQMKRRKQEKAALLSPDDDVQKSDVSSSSQGLVEKEALGPMLL
EALDGFFFVVNREGRIVFVSENVTSYLGYPQEELMTSSVYSILHVGDHSEFVRNLLPKSL
VNGVPWPQEPGRRNSHTFNCRMLKRPPDEVDSENPEARQQYEIMQCFTVSQPQSMQEEGE
DLQTCLICIACRIPRPQPFNTESFITRQDPTGKIISIETSALRATGRPGWEDLVRKCIYA
FFQPQGKEPSLAKKLLHEVMTHGSAVSPLYHFTLSDGTPLSAQTRCKFCCPPNPDVQPFI
MGIHTIDREHNTASSQENTNPSLPQNLGSLGQTPSRSPSLPPGSNWTQGSGVATSGLNPN
SSNGSSQGQNSSTPAGYLTPNRTCPQQLNSPSPLSSPLTAAPTSFISSRMPQVGPGLGES
PRITGNPFSPSTPGLHSPAGGTNSGGSLNRQHSGGDGTSSASSGSSGSFLSSPVHQRQTS
TPTSSSTRPPSVKPSEEGDEDSVKAPLSSASQVGNPRPSQFHDSNGTGSESSNSIHSTSL
PHPPAPTPQCPASHSTLTERHKILHRLLQDSSPNDSSANNEEGISQNPAEIKKEPPPSPA
MTSPIPKQDHQLLRFLLDTDEKDLGDLPPPSALSLQSIRAKVEKRTSIDSAPCAGSAIAA
ACKPAANCSSSSISPKSSPVGENRRDGRRDSRDSTMSGGPVDMDTITQLLPCLRGPTGAR
QGSEDSSTSGGGPQLQSPVPQPSAQLQSPVSQSLPQLQSPSPQLAPPSPQLKLQSPTQLQ
PAEASTPCGVNVKREPPGTPNRGPNDVVLSSGCSVQSQSAFDFCSPPTPSQTQEQGDPFQ
TPKHTSPFPEMDILNPFSSSSGLTKMDVGDAQFQPLALSDTLSFDALGTPLQAPLASPQE
QCVPCTLDDVLGPSNIPEARNDEKALIEQLVNFLSGTDESELAELDKALGIDKLVQSGCF
DPSGQSFLTQQPAVSPVAMDTKLPSYPSQFTPASQAQLPPELATVGPQGQGFGVPRAAFP
GGATGVGLRQGVMRPQGPQLRLSPNQLRLQLQQRLQAPQQLQNRMASVNQFPGGVQHVNM
GIRQGVQQPQLPTQQPPLNAQMLAQRQREIYSIQHRQRQLFQQKVMLMRQNMAGAPAGSV
GSIGTAQAPKVAPTTPQQPPQQQFSFPQVYNPLTGKPATSPSPFSPMTGGPLDNKVTVRV
PLNNQTLLGGVQGQFSTVNSSIQQGLFQQFSGSAMAQQEPPFPPEMSPTSPLLSPQNSTP
QTPLLQQAPPPGYQAADTKSWPPTGITSNSLFGQSGQGAGPAFGQQGVYNNMSITVSMAG
GSSGVSSLPPMGQPVAMSNSNLSSVSVVCSDQQVQQVQQVQVFADVQCTVNLVGSDSYMN
QGSGGTASSQKGPGTQGSQNNPAQQKSLLQQLLTE
NT seq 4428 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagtaggggaaaaccctctggaccctgccacctccgaggcacgcaagaggaag
ggctcaccatgcgacacctcagggccaagtctggagaagcggaggcgggagctggagtgt
cgctacatcgaggagctggctgaacttttgtcatccaacatgggcgacatcgccagcctc
agtgtcaagcccgacaagtgccacatcctcaagagtaccgtggaccaaatccagcagatg
aagaggcgcaagcaggagaaggcagctcttctgtctccagatgatgatgtccaaaagagt
gacgtctcctccagcagccagggcttggtggagaaggaggccctcgggccaatgctgctt
gaggccctggatggatttttctttgtcgtcaaccgagagggccgcattgtttttgtttcc
gagaatgtgacgagttaccttggataccctcaggaggagctgatgacttcaagcgtgtac
agcatccttcatgtgggagaccacagtgaatttgttcgcaatctgctgccaaaaagtctg
gtaaacggtgtgccgtggccacaagaacctggccggaggaacagccacacattcaactgt
cgtatgctcaagaggccaccggatgaggtggattcagaaaatccagaggccaggcaacaa
tatgagatcatgcagtgtttcactgtttcccaaccacagagcatgcaggaggaaggagag
gacctgcagacctgcctcatctgtatcgcctgtcggatacctcgccctcagcctttcaac
actgagtctttcatcacaagacaggacccaacagggaagatcatctccatagaaacaagt
gctctgcgagcgacgggacgacctggctgggaggatctggtcaggaagtgcatttacgct
ttctttcagccgcagggcaaagagccctccctcgctaagaagctgctgcatgaggtcatg
actcacggcagtgctgtcagcccgctgtaccatttcaccttaagtgacggcaccccactc
agtgctcagacccgctgcaagttctgctgtccccccaaccccgatgttcagcccttcatt
atgggcattcacactattgacagggaacacaacactgcaagctctcaggaaaacactaac
cccagccttccacagaaccttggcagccttggccaaaccccctctcgctccccttctctt
cctcctggcagcaactggacacaaggctcaggtgtcgccacctcgggccttaaccccaat
agcagtaacggctcctcccagggacagaactcatccacacctgcaggctacctaacaccc
aaccggacctgtccacagcaactcaacagtccctctcctctgagcagcccacttacagcc
gcccctacctcatttatttcatccaggatgccacaagttggtcctggattaggagaaagt
cctcggataacaggaaatcctttctccccttcaacgccaggcctccattccccagcaggg
ggaacaaacagtggaggcagcctgaacaggcagcattctggtggcgacggtactagcagt
gccagcagcggatcctcggggtccttcctttcgtctcctgtccatcaacgacagaccagt
acacccaccagctcctctacaaggcctccatcagtgaaaccctcagaagaaggggacgag
gactcagttaaagcccccctctcttctgcctcacaggtgggtaacccgaggcccagtcag
ttccatgatagcaacggaaccggaagtgaatccagcaacagcatccacagcacatcattg
cctcatcctccagcccccacccctcagtgccctgcatcccacagtacactcacggaacgg
cataagatcctgcaccggctgttgcaggacagtagtcccaatgattcatcagccaacaat
gaagaaggaataagtcaaaatccagcagagataaagaaggagccacctcccagtccagca
atgacttcaccaattcccaaacaagaccaccaacttctccgttttctgctggacacggat
gaaaaggacttgggggacctgccgcccccatccgctctcagcctgcagagcatcagagca
aaagtagagaagagaaccagcatcgactcggcgccctgcgcaggatctgctatcgcagcc
gcgtgcaaacctgcagcaaactgcagctcctcgagcatcagtcccaaatccagcccagtc
ggggagaaccgcagagacggccgccgcgacagccgggactccacgatgtctggtggccct
gttgacatggatactatcacccagctgctgccatgcctgagaggcccgactggggccagg
cagggtagcgaggattcatcaacctctggaggagggccccagctccagtctccagtcccc
cagccctcagcccagctccagtcccccgtctcacagtctcttccccagctgcagtcacct
tcaccacaactggcccctccttccccccagctgaaactccagtcacccactcagctgcag
cctgccgaggccagcactccctgcggtgtaaatgtgaaaagagagcctcctggcactcca
aacagaggaccgaatgatgtcgttctgtcatctggctgcagtgttcagagccagtcagct
tttgatttctgcagcccccccactccaagtcaaacccaggaacaaggcgaccccttccag
acccccaaacacaccagtccattcccagagatggacatcctcaacccattcagctcgagc
tctgggttaaccaaaatggatgtgggagacgctcagttccagcccctggctctgtctgac
accttgtcttttgatgctcttggaacccctttacaagctcccctggcatccccacaggag
cagtgtgtgccctgcactctggacgatgtgctcggtccatcaaacatacctgaagcccgg
aatgatgaaaaagctctgatcgagcagctcgtcaacttcctcagtgggactgatgagagt
gaattggctgagctggacaaggcgctgggtattgacaaactggtccagagtggctgtttt
gacccgtcgggccagagcttcctaacccagcagcctgctgttagcccagttgccatggac
actaaactcccctcctacccttcccagttcacaccagcttcacaagctcagctcccccca
gagctggccacagtgggtccacaagggcaggggttcggggtccccagagcagcattccct
ggtggggcgacaggtgttgggttaagacaaggggtaatgcgaccacagggcccccagctc
aggctgtcccccaaccaactgcggctccagctccagcagaggctgcaggctccacagcag
ctccagaacaggatggctagcgtgaatcagttcccaggaggagttcagcatgtgaacatg
gggattcgtcagggagttcaacaacctcaattgcccacacaacagcctcctctgaacgct
cagatgctggcccagcgtcaaagggaaatttatagcatccagcaccgccagcgccagctt
ttccagcagaaggtcatgctgatgagacagaacatggcaggtgctccagctgggtcggta
ggatccattggaacagcgcaagcacccaaagttgccccgacaacgcctcagcagccccca
caacagcagtttagcttcccacaagtatacaacccgctgacggggaaacccgctacctca
ccgagccccttcagtcccatgaccgggggtcctctggacaacaaagtaaccgtcagagtt
cccctgaataaccagacgctattggggggcgtgcagggccagttcagcaccgtgaactcg
tccatccaacagggcctgtttcagcagtttagcggttctgctatggcccagcaggagcca
cctttccctcctgagatgagcccgaccagcccgctgttgtcgcctcagaactccacgcca
cagactcctctgcttcagcaagccccgccccctggttaccaggcagcggacacaaaaagc
tggcctcccacgggcatcaccagcaacagcctgttcggccagtcaggccagggtgcaggg
ccggcctttggccagcagggggtttacaacaacatgagcatcactgtctccatggctgga
ggctccagtggtgtcagctcattacctcctatggggcaacccgttgccatgagcaacagt
aacctcagcagtgtcagtgtggtatgcagtgatcagcaggtgcagcaggtgcagcaggtg
caggtgtttgcagatgtccagtgcacagtcaacctggttgggagcgactcgtacatgaac
cagggctccggtgggaccgcgtcctcccagaagggcccgggaacgcagggctctcagaac
aacccggcccagcagaagagcctcctccagcagctgctcaccgagtga

DBGET integrated database retrieval system