KEGG   Takifugu rubripes (torafugu): 101063922Help
Entry
101063922         CDS       T02386                                 

Definition
calpain-1 catalytic subunit-like
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101063922
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101063922
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     101063922
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C2: calpain family
   101063922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 705 aa AA seqDB search
MEERIYATGMAYRLRSQWDREEGLGQNHKAVKFLGQDYERLKTQSLQSGRLFEDNLFPCS
ASSLGFNELGPRSSKTSGVRWIRPTEICKRPEFIVDGATRTDICQGALGDCWLLAAIASL
TLNDNLLHRVVPHGQSFAHGYIGIFHFQFWQFGEWVDVVIDDRLPVKDGKLLFVHSAEGT
EFWSALLEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYELRKAPSDLYSIISRALER
GSLLGCSINITSKFDMEAVTFKKLVKGHAYSVTAADEVVYRGSPTKLVRIRNPWGEVEWT
GPWSDNSREWDNVDRSVRSRLQNRSEDGEFWMGFNDFLREFTTLEICNLTPDALQNAQLK
KWSTSLYQGEWRRGSTAGGCRNYPATFWLNPQFKLVLKNPDVPGQSECSFLVGLMQKDRR
KKRRDGEDMETIGFAIYEVPREMAGRSGIHLKRDFFLTHASSARSELFINLREVSSRLQL
PAGEYVIVPSTFEPHKEANFVLRVFSEKPAQSEELDDEVVADIPKEERLDESQIDAGFKS
LFRQLAGPDMEISITELQTILNRIISKHKDLKTDGFSKEACRSMINLMDEDGSGKLGLTE
FHVLWEKIKRYLTIFRTFDLDKSGTMSSYEMRMALESAGFKLNNNLFQLIILRYTEADMS
VDFDNFVTCLVRLETMYKTFNSLDTDKDKVISLNFFQWITLTMFA
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcgcatctacgccacgggcatggcctacaggctgaggagccagtgggaccgc
gaagaaggtctggggcagaaccacaaggccgtcaagtttctgggccaggactacgagcgc
ctgaaaacccagagcctccagagtgggaggctgttcgaggacaaccttttcccctgcagc
gcgtcctcgctgggattcaacgagctcggcccgaggtcctctaagacctccggggtgcgc
tggataaggcctacggagatctgcaaacgtcccgagttcattgtggacggagccactcgc
acagacatctgtcagggagccctgggggactgctggctgctggcggccatcgcttcgctc
accttgaacgacaacctcctccaccgagtggtcccgcacggccagagctttgcgcacgga
tacatcggcatctttcacttccagttttggcagtttggcgagtgggtggatgtggtgatt
gatgacaggctgccggtgaaggacgggaagttgctgtttgtccactcggcggagggaacc
gagttctggagcgcgctgctggaaaaggcttatgctaagctgaacggctgttacgaggcg
ctgtcaggcggcagcacgtcggagggcttcgaggatttcacgggcggcgtgacggagatg
tacgagctgaggaaagcgccctctgacctctacagcatcatcagcagggcgctggagaga
gggtcgctgctgggctgctccatcaacatcaccagcaaatttgacatggaggctgtgacg
ttcaagaagctggtgaagggtcacgcgtactctgtcaccgccgcagacgaggtggtgtac
agaggaagtccaaccaagctggtgcggatcagaaacccctggggggaagtggagtggacc
ggaccctggagtgacaactccagagagtgggacaacgtggatcgctccgtgagaagccgc
ctacaaaaccgcagcgaggacggggagttctggatgggattcaacgacttcctgcgcgaa
ttcaccaccctggagatctgcaacctgacccctgatgccctgcagaacgcccagctaaag
aagtggagcacctcgctctaccagggcgagtggaggagggggagcaccgctgggggctgc
aggaactatccagccaccttttggctcaacccacagttcaagctggtgctgaagaaccct
gacgtgcccggtcaatcggaatgcagcttcctggtcggcctcatgcagaaggaccgtagg
aagaaacggcgagacggcgaagacatggagaccatcgggtttgccatctatgaggttccc
cgagagatggccggcaggtcggggatccacctgaagcgagactttttcctcacccatgct
tctagcgctcgctccgagctcttcatcaacctgagggaggttagctcgcggctccagctg
cctgctggagaatacgtcattgtcccgtccacgttcgagccacacaaagaggccaacttc
gtccttagggttttctcggaaaagcccgcccagtcggaagagctggatgatgaagttgta
gcagatattccgaaggaggaacgtttggacgagagccagatcgacgctggatttaagagc
ctcttcaggcagctagctgggccggacatggagatcagcatcacagagctgcagaccata
ctgaacaggatcatcagcaaacataaagacctgaagacagacggcttctcgaaagaagct
tgtcgcagcatgattaacctcatggacgaggacgggagtggaaaattgggtctgacagag
ttccatgtcctctgggagaagattaaacgatatctgacaatcttcaggaccttcgatttg
gacaaatcgggcaccatgagctcctacgaaatgaggatggcccttgaatctgcagggttc
aagctaaacaacaacctgttccagctcatcatcctgcgctacacggaggccgacatgtcc
gtggactttgacaactttgtcacatgtctggtcagattggagaccatgtacaagaccttt
aacagtttggacacagacaaagacaaagtcatcagcctcaacttcttccagtggatcacc
ctgaccatgtttgcctag

DBGET integrated database retrieval system