KEGG   Takifugu rubripes (torafugu): 101063922Help
Entry
101063922         CDS       T02386                                 

Definition
(RefSeq) calpain-1 catalytic subunit-like
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101063922
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101063922
   04217 Necroptosis
    101063922
   04218 Cellular senescence
    101063922
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     101063922
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C2: calpain family
   101063922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 705 aa AA seqDB search
MEERIYATGMAYRLRSQWDREEGLGQNHKAVKFLGQDYERLKTQSLQSGRLFEDNLFPCS
ASSLGFNELGPRSSKTSGVRWIRPTEICKRPEFIVDGATRTDICQGALGDCWLLAAIASL
TLNDNLLHRVVPHGQSFAHGYIGIFHFQFWQFGEWVDVVIDDRLPVKDGKLLFVHSAEGT
EFWSALLEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYELRKAPSDLYSIISRALER
GSLLGCSINITSKFDMEAVTFKKLVKGHAYSVTAADEVVYRGSPTKLVRIRNPWGEVEWT
GPWSDNSREWDNVDRSVRSRLQNRSEDGEFWMGFNDFLREFTTLEICNLTPDALQNAQLK
KWSTSLYQGEWRRGSTAGGCRNYPATFWLNPQFKLVLKNPDVPGQSECSFLVGLMQKDRR
KKRRDGEDMETIGFAIYEVPREMAGRSGIHLKRDFFLTHASSARSELFINLREVSSRLQL
PAGEYVIVPSTFEPHKEANFVLRVFSEKPAQSEELDDEVVADIPKEERLDESQIDAGFKS
LFRQLAGPDMEISITELQTILNRIISKHKDLKTDGFSKEACRSMINLMDEDGSGKLGLTE
FHVLWEKIKRYLTIFRTFDLDKSGTMSSYEMRMALESAGFKLNNNLFQLIILRYTEADMS
VDFDNFVTCLVRLETMYKTFNSLDTDKDKVISLNFFQWITLTMFA
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcgcatctacgccacgggcatggcctacaggctgaggagccagtgggaccgc
gaagaaggtctggggcagaaccacaaggccgtcaagtttctgggccaggactacgagcgc
ctgaaaacccagagcctccagagtgggaggctgttcgaggacaaccttttcccctgcagc
gcgtcctcgctgggattcaacgagctcggcccgaggtcctctaagacctccggggtgcgc
tggataaggcctacggagatctgcaaacgtcccgagttcattgtggacggagccactcgc
acagacatctgtcagggagccctgggggactgctggctgctggcggccatcgcttcgctc
accttgaacgacaacctcctccaccgagtggtcccgcacggccagagctttgcgcacgga
tacatcggcatctttcacttccagttttggcagtttggcgagtgggtggatgtggtgatt
gatgacaggctgccggtgaaggacgggaagttgctgtttgtccactcggcggagggaacc
gagttctggagcgcgctgctggaaaaggcttatgctaagctgaacggctgttacgaggcg
ctgtcaggcggcagcacgtcggagggcttcgaggatttcacgggcggcgtgacggagatg
tacgagctgaggaaagcgccctctgacctctacagcatcatcagcagggcgctggagaga
gggtcgctgctgggctgctccatcaacatcaccagcaaatttgacatggaggctgtgacg
ttcaagaagctggtgaagggtcacgcgtactctgtcaccgccgcagacgaggtggtgtac
agaggaagtccaaccaagctggtgcggatcagaaacccctggggggaagtggagtggacc
ggaccctggagtgacaactccagagagtgggacaacgtggatcgctccgtgagaagccgc
ctacaaaaccgcagcgaggacggggagttctggatgggattcaacgacttcctgcgcgaa
ttcaccaccctggagatctgcaacctgacccctgatgccctgcagaacgcccagctaaag
aagtggagcacctcgctctaccagggcgagtggaggagggggagcaccgctgggggctgc
aggaactatccagccaccttttggctcaacccacagttcaagctggtgctgaagaaccct
gacgtgcccggtcaatcggaatgcagcttcctggtcggcctcatgcagaaggaccgtagg
aagaaacggcgagacggcgaagacatggagaccatcgggtttgccatctatgaggttccc
cgagagatggccggcaggtcggggatccacctgaagcgagactttttcctcacccatgct
tctagcgctcgctccgagctcttcatcaacctgagggaggttagctcgcggctccagctg
cctgctggagaatacgtcattgtcccgtccacgttcgagccacacaaagaggccaacttc
gtccttagggttttctcggaaaagcccgcccagtcggaagagctggatgatgaagttgta
gcagatattccgaaggaggaacgtttggacgagagccagatcgacgctggatttaagagc
ctcttcaggcagctagctgggccggacatggagatcagcatcacagagctgcagaccata
ctgaacaggatcatcagcaaacataaagacctgaagacagacggcttctcgaaagaagct
tgtcgcagcatgattaacctcatggacgaggacgggagtggaaaattgggtctgacagag
ttccatgtcctctgggagaagattaaacgatatctgacaatcttcaggaccttcgatttg
gacaaatcgggcaccatgagctcctacgaaatgaggatggcccttgaatctgcagggttc
aagctaaacaacaacctgttccagctcatcatcctgcgctacacggaggccgacatgtcc
gtggactttgacaactttgtcacatgtctggtcagattggagaccatgtacaagaccttt
aacagtttggacacagacaaagacaaagtcatcagcctcaacttcttccagtggatcacc
ctgaccatgtttgcctag

DBGET integrated database retrieval system