KEGG   Takifugu rubripes (torafugu): 101063947Help
Entry
101063947         CDS       T02386                                 

Definition
(RefSeq) Na(+)/H(+) exchange regulatory cofactor NHE-RF2-like
  KO
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
tru  Takifugu rubripes (torafugu)
Brite
Transporters [BR:tru02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   101063947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 375 aa AA seqDB search
MTSERKPRLCLMTKGDSGYGFHLHGEKGKSGQFIRKVEPGSPAEASGLRAGDRLVAVNGV
NVEKETHHQVVQRIKAVDNETRLLVVDPETQESLRSLRLTATEDMAVPGTGQHNSCPSPT
ASSSSVPSSTSKKQENGSASKLPMAASNQVQKPTRRSPSKAATKETPPQTDSQTQSHSQP
KVDPSRLAPRLCHLVRSENGYGFNLHSDRSRPGQYIRSLDPGSPADRAGLRPQDRLIEVN
GTNIEGMRHADVVAFIKRGGDETWLLVVDPETDAHFKKRGVVPTVALVTDYDGPSISNGS
TGARLNGSSSTHSTLSSRGNSTQLADEEGSRMMDPFAEMGLSATAAEEKMKIHAKEKKKA
PQMDWIKKYELFSNF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgagcggaaaccgcggctctgtctcatgacaaaaggggacagcgggtatgga
tttcacttgcatggtgagaaaggaaagagcggtcaattcatccgcaaagtggagcccggt
tcccctgcagaagcgtcggggctgcgcgccggggaccgtttggtggcggtgaatggcgtc
aacgtggagaaggaaactcaccatcaggtggtccagcggatcaaagcggtggacaatgag
acccggctcctggtggtggatcccgagacgcaagaatctctgcgcagcctgcgtctcaca
gccacagaggacatggctgttcctggcacagggcagcacaactcctgtccttctcccacg
gcctcgtcgtcctctgttccgtcctccacgagcaaaaagcaggagaatggatcagcgtcc
aagctgcccatggcagcgagcaaccaggtccagaagcccaccaggaggtcaccttccaag
gctgcgacaaaggagacccctccccagaccgacagtcagacccagtcccattcgcaaccc
aaggtggacccgtccagactggcgccgcgtctctgccacctggtgcgctctgaaaatggt
tacggcttcaacctgcacagtgaccgatcccggcccggccagtacatccgctccctcgac
ccgggatctcccgcggaccgtgccgggctccgcccacaagacaggctgatcgaggtcaat
ggcacaaacatcgagggaatgaggcacgcggacgtggtggccttcatcaagaggggcgga
gatgagacctggctgttggtggtggaccctgagactgacgcccatttcaagaagaggggg
gtcgttcccaccgtcgccctggtcacagactacgatggtccatcaatatcgaacggctcc
accggcgctcgcttgaacggcagctcctccacacactccaccctcagcagccgcggaaac
agcacacagctggcagatgaagaaggcagccggatgatggaccccttcgctgagatgggc
ctcagcgctacggcggcggaggagaagatgaagatccatgccaaagagaagaagaaggcc
ccgcagatggactggataaagaagtacgagctgttcagcaacttctga

DBGET integrated database retrieval system