KEGG   Takifugu rubripes (torafugu): 101063947Help
Entry
101063947         CDS       T02386                                 

Definition
Na(+)/H(+) exchange regulatory cofactor NHE-RF2-like
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
tru  Takifugu rubripes (torafugu)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 330 aa AA seqDB search
MTSERKPRLCLMTKGDSGYGFHLHGEKGKSGQFIRKVEPGSPAEASGLRAGDRLVAVNGV
NVEKETHHQVVQRIKAVDNETRLLVVDPETQESLRSLRLTATEDMAVPGTGQHNSCPSPT
ASSSSVPSSTSKKQENGSASKLAPRLCHLVRSENGYGFNLHSDRSRPGQYIRSLDPGSPA
DRAGLRPQDRLIEVNGTNIEGMRHADVVAFIKRGGDETWLLVVDPETDAHFKKRGVVPTV
ALVTDYDGPSISNGSTGARLNGSSSTHSTLSSRGNSTQLADEEGSRMMDPFAEMGLSATA
AEEKMKIHAKEKKKAPQMDWIKKYELFSNF
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgagcggaaaccgcggctctgtctcatgacaaaaggggacagcgggtatgga
tttcacttgcatggtgagaaaggaaagagcggtcaattcatccgcaaagtggagcccggt
tcccctgcagaagcgtcggggctgcgcgccggggaccgtttggtggcggtgaatggcgtc
aacgtggagaaggaaactcaccatcaggtggtccagcggatcaaagcggtggacaatgag
acccggctcctggtggtggatcccgagacgcaagaatctctgcgcagcctgcgtctcaca
gccacagaggacatggctgttcctggcacagggcagcacaactcctgtccttctcccacg
gcctcgtcgtcctctgttccgtcctccacgagcaaaaagcaggagaatggatcagcgtcc
aaactggcgccgcgtctctgccacctggtgcgctctgaaaatggttacggcttcaacctg
cacagtgaccgatcccggcccggccagtacatccgctccctcgacccgggatctcccgcg
gaccgtgccgggctccgcccacaagacaggctgatcgaggtcaatggcacaaacatcgag
ggaatgaggcacgcggacgtggtggccttcatcaagaggggcggagatgagacctggctg
ttggtggtggaccctgagactgacgcccatttcaagaagaggggggtcgttcccaccgtc
gccctggtcacagactacgatggtccatcaatatcgaacggctccaccggcgctcgcttg
aacggcagctcctccacacactccaccctcagcagccgcggaaacagcacacagctggca
gatgaagaaggcagccggatgatggaccccttcgctgagatgggcctcagcgctacggcg
gcggaggagaagatgaagatccatgccaaagagaagaagaaggccccgcagatggactgg
ataaagaagtacgagctgttcagcaacttctga

DBGET integrated database retrieval system