KEGG   Takifugu rubripes (torafugu): 101064007Help
Entry
101064007         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 11-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 963 aa AA seqDB search
MTANSRCPTAEPPGLETQQREIDSLLRQCELRAGDTWYMVERRWYEQWKEFVETGDQNSS
SFPGQIDNTELFDDLDSFHIKDRLVENEDFMLVPAEAWHKLLSWYGMVDGQPPLERKVVD
LPSTVKVEIYPIELFLCLHSNMENVVTLQFSRTDNIYTIQRAMCAAFAVPVGSECRLWMK
SSDSSCERLRNMHMSVLDACLSTGMTVVMETRNADGTWPSSRPQIMRNSVEEHDSYRGQP
GVCGLTNLGNTCFMNSALQCLSNTPPLTEYFLRNSYLDELNFTNPLGMKGEIAEAYADVI
KQMWSGRHYSVVPRIFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKNKEYIE
LRDADGRADQEVAKEAWRNHRRRNDSVIVDTFHGLFKSTLICPECQKISVTFDPFCYLSV
PLPVSKERIMEVFFVSLDPHAKPAQHRVVVPKAGKVSDLCAALAEMTDVPPSQMVVADVF
NHRFYKIYTSDESLSCILDRDDIFVYELSMSGEQQEEQVLLALYLRERSHYRDYGSGSSS
YSTTLFGHPLLLSVPRSRFSQEALYDLFLQRLARYVRPPDPSDQLEEEEEEEEQYRSQSN
GISDGDEEQKEEAKAGPSHTRARQAELNHTQPSLDGSDSDTPNGSHNQTEPVCPAGTDSA
DSTSDVSPGGLSPAEPGPEPAARQPQQPRDATEEELEEEKLDEACSPCSPANEQPAKRRA
HHKRKKNLFTIQAVNSNGTTERGMGEGGTQPYVAIDWDPEMKKRFYNENEAEKYVKHASM
DVPLQQTTVQLQECIELFTTVETLEEENPWYCPVCKKHQLATKKLDLWSLPEVLIIHLKR
FSYTKLTREKLESVVEFPLRDLDFSGFLLRKTVSSEEPPSCYDLIAVSNHYGGLRDGHCR
TLCFTSAAYVLFYQRKDKIRKPTLPTPNTSSAPTAQLANDITSCSDGGTEAGVAASYITM
ETD
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaacagccgctgtcccacagcggagcctccgggtctggagacccagcaacgg
gagattgattccttgctgcggcagtgtgagctccgcgctggggacacttggtacatggtg
gaacgtcgctggtatgaacaatggaaggagtttgtggagactggagaccagaactcgtca
tcatttccaggtcaaattgacaacacagagctgttcgacgatctggactcgttccacatt
aaggaccgtctggtggagaatgaagactttatgttggtgccagctgaggcctggcacaag
ctgctgtcctggtacgggatggtggacggacaaccgcccctggaacgcaaggtggtggac
ctgcccagcaccgtgaaggtggaaatttatcccattgagctcttcctctgtctccatagc
aacatggagaatgtcgtcaccttacagttcagccgaactgacaacatctacaccatccag
agggccatgtgcgcagcctttgcggtgccggtgggttctgagtgtcgtttgtggatgaag
agctcagatagcagctgtgagcgtctcaggaacatgcacatgagcgtcctggacgcctgt
ctgagcacagggatgacagtcgtcatggaaacaaggaacgcagatggcacctggccgagc
tccaggcctcagatcatgaggaactctgtggaggagcacgactcgtataggggacagcca
ggagtctgtggtctcaccaacctgggcaacacctgcttcatgaactcagcactacagtgc
ctgagtaacacgccccctctgaccgagtacttcctgcggaactcctacctggacgagctc
aacttcaccaaccctctggggatgaagggagagattgctgaggcctacgcagacgttatc
aagcagatgtggtctgggcgccattactctgtagtcccccgcatcttcaagacgaaggtg
ggtcactttgcgtcccagttcctgggataccagcagcacgatagtcaggagctgctgtcc
ttcctgttggatgggctgcatgaagacctgaaccgagtcaaaaacaaggagtacatcgag
ctgcgggacgcagacggacgagcggaccaggaagtggccaaggaggcgtggcgtaaccac
cggcggaggaacgactcggtcattgtggacacgtttcacggcctcttcaagtcgacgctc
atctgcccagagtgtcaaaaaatctcagtgacctttgaccccttctgctacctgagcgtg
ccgcttcctgtcagtaaggagcgcatcatggaggtcttctttgtctccctggacccgcac
gccaaacctgcacagcatcgggtcgtggttcctaaagccggaaaggtgtccgacctgtgt
gctgctctggcagaaatgacggacgttcccccgtcacagatggtggtcgctgatgtcttc
aaccatcgtttctacaagatctacaccagtgacgagtccctcagctgtattctggaccga
gacgacatctttgtgtacgagctgagcatgagtggggagcagcaggaggagcaggtgctg
ctggcgctctacctcagggaacgctcccactaccgggactacggctccggcagcagctcc
tacagcaccacgctgttcggacacccgctgctgctcagcgttccccgcagccgcttcagc
caggaggctctgtatgacctgttcctgcagaggctggcacgttacgtgcgccctcctgac
ccgtcggaccagttggaggaggaggaggaggaagaggagcagtacagaagtcagtccaac
ggcatcagcgacggagatgaggagcagaaggaggaggccaaggctggaccctcccacaca
cgggcccgccaagctgagctcaaccacacgcaaccctcgctggacggcagcgactccgac
acccccaacggctcacacaaccagaccgaacccgtctgtcctgccggcactgacagcgcc
gacagcaccagcgacgtcagtcccggcggtctttcccctgcagaacctggaccagaaccg
gcggcacgacagccgcagcagccccgagacgccacagaagaagagctagaggaagagaag
ctggacgaggcctgttctccctgctcaccagccaatgagcagccagctaagagaagggcg
catcacaagaggaagaagaacctgttcaccatccaggctgtcaactccaacggtaccact
gagagagggatgggggaaggggggactcagccttatgtggccatcgactgggaccccgaa
atgaagaagagattctacaatgaaaatgaggctgagaaatatgtgaaacacgccagtatg
gacgttcctctgcagcagaccacagttcagctgcaggagtgtatcgagctgttcaccact
gtggagacactggaggaggagaatccatggtactgtcctgtgtgtaagaagcatcagttg
gccacaaagaaactggacctgtggtccctgccagaggttctgatcatccacctcaagagg
ttctcctacaccaaactgaccagagagaagctggagagcgtcgtggagttccccctcagg
gacctggacttctctggcttcctgctcaggaaaaccgtgtccagcgaggagcctcccagc
tgttatgacctcatcgccgtgtctaaccactatggaggactgagggacggacactgtagg
acgctttgctttaccagtgcagcctacgtgctcttctaccagcgtaaagacaagatccgg
aagcccaccttgccgacccccaacacaagctccgcccccacagcccagctggccaatgac
atcacctcctgcagcgatgggggcacagaagcgggtgtggcggcgtcttacatcaccatg
gaaacggactga

DBGET integrated database retrieval system