KEGG   Takifugu rubripes (torafugu): 101064009Help
Entry
101064009         CDS       T02386                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101064009
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     101064009
Glycosyltransferases [BR:tru01003]
 Glycan extension
  Type 3 chain
   101064009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 385 aa AA seqDB search
MKFSSSRWAFCLGFLVGAFSGHFFLSQAWFERSYPVLSEAQERGSMVVEESPTNWRKDGA
AFFNLLHPHHPDEDSGLADMLYQKVRVLCWVMTGPYNLQRRARHVRATWSRHCNVVVFMS
SVEDPDFPTVGLGTKEGRDQLYWKTIRAFHYVYEHHARDADWFLKADDDTYVVVDNLRWV
LSNHTPDEPIYFGKRFKPYTKQGYMSGGAGYVLSKEALKRFVVGFRTKVCTHSTPVEDLA
LGQCLEKMGVAAGDSRDTLHRETFHPFVPEHHLTSTFSKSFWYWSYCYYPIVEGPQCCSD
LAVSFHYVEAQLMYVLEYYTYHLRAHGYRPRYRPSVGQKGLSFSPRPQPTVHTGPKWTQG
STDGRSHTTPSSVAEGNRTRTEKMR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctccagctccagatgggccttctgcttgggcttcctggtcggagccttcagc
ggtcacttttttctgtctcaagcgtggtttgagaggagctaccctgtgctgtcagaggcc
caggaaagaggctccatggtggtggaggagagcccgaccaactggaggaaagatggggct
gctttcttcaacctgctgcaccctcaccacccagatgaagacagcgggcttgcagatatg
ttgtaccagaaagtgcgtgttctctgttgggtgatgactggtccgtataacttgcaacgc
agagctcgtcatgtcagggccacctggagtcggcattgcaatgtggtggtgttcatgagc
tctgtggaggatccagacttccccacagtgggcctcggcaccaaggagggccgcgaccag
ctctactggaagacgatccgagccttccactacgtgtacgagcaccatgccagggacgcc
gactggttcctgaaggcggacgacgacacctacgtcgtggtggacaacctgcgctgggtt
ctgtcgaaccacacccccgacgagcccatttactttggcaaacgcttcaagccgtacacc
aagcaaggctacatgagcggaggggcgggatacgtgctcagcaaggaggctttgaagcgg
ttcgtggtaggtttccggaccaaagtgtgcacgcactccacccctgttgaggacctggcg
ctggggcagtgtttggagaagatgggcgttgcagcaggagactccagagacactctacat
agagaaacatttcacccgtttgtgccagagcaccatttaaccagcacattctccaagagc
ttctggtactggagctattgttactaccctattgttgagggtccccagtgctgctctgac
ctcgcggtatctttccattacgtcgaggcgcaactgatgtacgtgctggagtactacacc
taccacctgagagcgcatggctacaggccacgttaccgcccttctgtgggacagaaaggc
ctgagcttcagccctcgcccgcagccaactgtgcacacgggacctaagtggacacagggc
tcgacggatggaaggagtcacacgacaccatcgtctgtggctgaaggaaaccgaactaga
acagaaaaaatgaggtga

DBGET integrated database retrieval system