KEGG   Takifugu rubripes (torafugu): 101064045Help
Entry
101064045         CDS       T02386                                 

Definition
(RefSeq) mitogen-activated protein kinase 11-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04068  FoxO signaling pathway
tru04218  Cellular senescence
tru04261  Adrenergic signaling in cardiomyocytes
tru04370  VEGF signaling pathway
tru04620  Toll-like receptor signaling pathway
tru04621  NOD-like receptor signaling pathway
tru04622  RIG-I-like receptor signaling pathway
tru04625  C-type lectin receptor signaling pathway
tru04912  GnRH signaling pathway
tru04914  Progesterone-mediated oocyte maturation
tru04933  AGE-RAGE signaling pathway in diabetic complications
tru05132  Salmonella infection
Module
tru_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101064045
   04370 VEGF signaling pathway
    101064045
   04068 FoxO signaling pathway
    101064045
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    101064045
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101064045
   04621 NOD-like receptor signaling pathway
    101064045
   04622 RIG-I-like receptor signaling pathway
    101064045
   04625 C-type lectin receptor signaling pathway
    101064045
  Endocrine system
   04912 GnRH signaling pathway
    101064045
   04914 Progesterone-mediated oocyte maturation
    101064045
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101064045
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101064045
  Infectious diseases
   05132 Salmonella infection
    101064045
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101064045
Protein kinases [BR:tru01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101064045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101064045
NCBI-ProteinID: XP_003972999
Position
18
AA seq 361 aa AA seqDB search
MSARSGFYRQELNKTVWEVPERYQNLTPVGSGAYGSVCSAYDVVLRQKVAVKKLSRPFQS
LIHCRRSYRELRLLKHMKHENVIGLLDVFTPAAALEDFSELYLVTNLMGADLNNIVKFQK
LSDEHVQFLIYQLLRGLKYIHSAGLVHRDLKPSNVAVNEDCELRILDFGLARQTDDEMTG
YVATRWYRAPEIMLNWMHYNQNVDIWSVGCIMGELLKGKVLFPGTDYIDQLKRIMEVVGT
PTAELLKKICSEHAQKYIQSLPSMPPQDMEKIFRGANPLAVDLLKRMLILDCDGRISASE
ALAHPYFSQYHDPDDEPEAPPYDQSLESKDRTLEEWKELIFKELSSFKVSGSKSDSLPVE
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccagatcgggattctatcggcaggagctgaacaagacggtgtgggaggttccg
gagcggtaccagaacctgacgccggtgggctccggagcctacggctcggtgtgctccgcc
tacgacgtggttttacggcagaaggtggcggtgaagaagctgtcccggcctttccagtcc
ctcatccactgccggcgctcctaccgggaactgaggctgctcaagcacatgaaacacgag
aacgtcatcgggctgctggacgtcttcacgccggctgcagcgttggaggacttcagcgag
ctctacctggtgacgaacctgatgggcgccgacctcaacaacatcgtgaaattccagaag
ctgtccgacgagcacgtgcagttcttgatttaccagctcctgcgaggactcaagtacatc
cactcggcaggactggtccacagggacctcaagccgagcaacgtggcggttaatgaagac
tgcgagctgaggatcctggattttgggctggccagacagacggacgacgagatgacgggt
tacgtggcgacgcggtggtacagagcgccggagatcatgctgaactggatgcactacaac
cagaacgttgatatctggtcagtgggatgcatcatgggagagctgctgaaaggaaaagtg
cttttccccggaactgactacattgaccagctgaagaggatcatggaggtggtgggaacg
ccgacggccgagctgctgaagaagatctgctctgaacacgcgcagaagtacatccagtct
ctgccgtccatgcctcctcaggacatggagaagatcttccggggagcgaaccccctggcc
gtcgacctcctcaagcgaatgctgattctggactgtgatgggaggatctctgccagcgag
gccctggcccacccctacttctcacagtaccacgatccagatgacgagcctgaagccccc
ccttacgatcaaagcctggagagcaaagaccggactctagaggagtggaaagagttgata
tttaaagagctgagcagcttcaaagtctccggcagcaagtcggacagcctcccggtggag
cagtag

DBGET integrated database retrieval system